[감염병연구] |
폐질환·폐암(편평상피세포암) 환자 의료 및 인산화단백체 데이터 폐질환·폐암(편평상피세포암) 환자 의료 및 인산화단백체 데이터
|
데이터 기본 이용료
|
데이터등록일 | 데이터 수정일 | 데이터 이용기한 | 판매제공처 |
---|---|---|---|
2022-12-16 | 2023-07-05 | 무기한 | 셀키 |
데이터 제공포맷 | 데이터 제공방식 | 데이터 파일용량 | 데이터 상품구분 |
csv/zip | 다운로드 | 3.91 GB | dataset |
● 데이터 상품명 폐질환·폐암(편평상피세포암) 환자 의료 및 인산화단백체 데이터 ● 데이터 상품 부제 암 특화 임상 및 인산화단백체 데이터와 의료데이터 ● 데이터 상품 요약 미국 국립암연구소 (NCI), 가톨릭대학교 의과대학의 폐질환·폐암(선암) 의료 및 단백체 정성·정량 분석 결과 ● 데이터 상품 정보 ■ 상품 설명 및 특징 - 국내 최초·최대 암 관련 (관련 질병 포함) 당 단백질 질량분석 실험 데이터의 해석 및 당·단백질 리포지토리를 구축하고 정밀의료 연구기술에 발전시키고자 함 - 참여 병원으로부터 제공된 폐질환 폐암(선암) 환자 시료를 전처리하여 고분해능 질량분석기기를 통해 최적화된 분석을 진행하고 당사에서 자체 개발한 분석솔루션 SpAC9 Pipeline을 활용하여 데이터분석 등의 프로세스를 통하여 표준화 기준에 맞춰 최종 데이터를 가공, 생산함 - NCI 의 CPTAC에서 제공된 질량분석이 완료된 선암 RAW 데이터는 SpAC9 Pipeline을 활용하여 재분석하고 표준화 기준에 맞춰 데이터를 가공·생산함 ■ 기간 및 범위 - 2022년 9월 ~ 2022년 10월 ■ 컬럼(속성) 정보 - 집계시작년월 : 2022년 9월 - 집계시작년월 : 2022년 10월 ■ 약어/전문용어 설명 - NCI: National Cancer Institute - CPTAC: Clinical Proteome Tumor Analysis Consortium ■ 활용 예제 - 시스템 확대·발전 - 의료 및 단백체 빅데이터 고도화를 위한 유전단백체 변이 아틀라스 구축으로 시스템 확대 및 발전 - 인간의 유전단백체 변이 아틀라스를 구축하여 질병 별로 유전자 변이가 단백질의 변이를 일으키는 경우의 데이터베이스 구축하여 질병의 이해와 개인 맞춤형 신약 개발 및 진단 발굴 사업에 필요한 데이터를 제공
그룹명
|
결과파일명
|
결과ID
|
질량분석기기분석일자
|
생성일자
|
수정일자
|
ID
|
환자ID
|
샘플ID
|
암코드
|
분석정보
|
샘플타입
|
환자나이
|
환자성별
|
환자인종
|
환자민족인종
|
환자종양위치
|
환자종양크기
|
병리학적종양타입명
|
병리학적종양등급
|
종양병소
|
종양측향화
|
병리학적병기분류
|
환자국적
|
종양괴사
|
병리학적진단
|
종양분화도
|
간경변병력
|
간결절크기
|
간염병력
|
B형간염표면항원
|
B형간염코어항체
|
프로트롬빈함량
|
빌리루빈함량
|
알부민함량
|
알라닌아미노전이효소함량
|
감마글루타밀전이효소함량
|
알파태아단백질함량
|
아스파르테이트아미노전달효소함량
|
알칼리인산분해효소함량
|
TNM병기분류
|
BCLC병기분류
|
AJCC병기분류
|
원발성종양병리학적상태
|
림프절전이병리학적상태
|
타장기전이병리학적상태
|
종양전이범위
|
암진단이력
|
치료이력
|
잔여종양병리학적상태
|
음주량
|
흡연이력
|
흡연나이
|
금연나이
|
하루흡연량
|
연간흡연량
|
12개월간종양크기
|
24개월간종양크기
|
유전자심볼
|
단백질심볼
|
단백질명
|
펩타이드명
|
펩타이드질량
|
펩타이드전하
|
펩타이드스캔1ID
|
펩타이드스캔2ID
|
펩타이드값
|
펩타이드함량
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3712543 | C3N-00221 | LUSC | Tumor_and_Normal | 78 | Male | Not Reported | Not-Hispanic or Latino | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage III | Other: TSS did not collect this information | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | DCN | NP_001911.1(pre=R,post=V) | decorin isoform a preproprotein GN=DCN | AHENEITK__0 | 467.2699 | 3 | 11846 | 11847 | 62.0 | 1391470000.0 | ||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3712544 | C3L-04013 | LUSC | Tumor_and_Normal | 61 | Male | Other | 8 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIB | Bulgaria | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | Staging Incomplete | DCN | NP_001911.1(pre=R,post=V) | decorin isoform a preproprotein GN=DCN | AHENEITK__0 | 467.2699 | 3 | 11846 | 11847 | 62.0 | 1391470000.0 | ||||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3712545 | C3L-00568 | LUSC | Tumor_and_Normal | 74 | Female | White | Hispanic or Latino | Upper Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IB | United States | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | DCN | NP_001911.1(pre=R,post=V) | decorin isoform a preproprotein GN=DCN | AHENEITK__0 | 467.2699 | 3 | 11846 | 11847 | 62.0 | 1391470000.0 | ||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5584603 | C3L-02170 | LUSC | Tumor | 73 | Male | Lower Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IB | Bulgaria | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | NHS | NP_001278796.1(pre=K,post=R) | Nance-Horan syndrome protein isoform 3 GN=NHS | LAGLASPSSGYSSQSETPTSSFPTAFFSGPLSPGGSK_LAGLAS[0.00]PS[0.00]S[0.00]GY[0.00]S[0.00]S[0.00]QS[0.00]ET[0.00]PT[0.00]S[0.00]S[0.00]FPT[0.00]AFFS[0.00]GPLS[99.99]PGGS[0.01]K_1 | 1033.2584 | 4 | 46458 | 46466 | 39.0 | 0.0 | ||||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5584604 | C3L-01285 | LUSC | Tumor_and_Normal | 54 | Male | White | Not-Hispanic or Latino | Upper Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | United States | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | Staging Incomplete | NHS | NP_001278796.1(pre=K,post=R) | Nance-Horan syndrome protein isoform 3 GN=NHS | LAGLASPSSGYSSQSETPTSSFPTAFFSGPLSPGGSK_LAGLAS[0.00]PS[0.00]S[0.00]GY[0.00]S[0.00]S[0.00]QS[0.00]ET[0.00]PT[0.00]S[0.00]S[0.00]FPT[0.00]AFFS[0.00]GPLS[99.99]PGGS[0.01]K_1 | 1033.2584 | 4 | 46458 | 46466 | 39.0 | 0.0 | ||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5584605 | C3L-00993 | LUSC | Tumor_and_Normal | 75 | Male | Lower Lobe | 6 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | Ukraine | Seventh Edition (2010) | pT2b | pN2 | No pathologic evidence of distant metastasis | cM0 | NHS | NP_001278796.1(pre=K,post=R) | Nance-Horan syndrome protein isoform 3 GN=NHS | LAGLASPSSGYSSQSETPTSSFPTAFFSGPLSPGGSK_LAGLAS[0.00]PS[0.00]S[0.00]GY[0.00]S[0.00]S[0.00]QS[0.00]ET[0.00]PT[0.00]S[0.00]S[0.00]FPT[0.00]AFFS[0.00]GPLS[99.99]PGGS[0.01]K_1 | 1033.2584 | 4 | 46458 | 46466 | 39.0 | 0.0 | ||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093157 | C3N-03093 | LUSC | Tumor_and_Normal | 70 | Female | Squamous cell carcinoma | G3 Poorly differentiated | Ukraine | UBN1 | NP_001072982.1(pre=R,post=E) | ubinuclein-1 isoform a GN=UBN1 | QASESEDDFIK_QAS[100]ES[100]EDDFIK_2 | 943.9116 | 2 | 29245 | 29247 | 64.0 | 2597870000.0 | ||||||||||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093407 | C3N-03093 | LUSC | Tumor_and_Normal | 70 | Female | Squamous cell carcinoma | G3 Poorly differentiated | Ukraine | DEK | NP_003463.1(pre=D,post=K) | protein DEK isoform 1 GN=DEK | SSDDEPLIK_S[100]S[100]DDEPLIK_2 | 811.378 | 2 | 29493 | 29502 | 59.0 | 186030000.0 | ||||||||||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093589 | C3N-00555 | LUSC | Tumor_and_Normal | 59 | Male | Middle Lobe | 6 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Vietnam | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | NP_001025062.1(pre=R,post=D) | SYDVPPPPMEPDHPFYSNISK_S[50.00]Y[50.00]DVPPPPMEPDHPFY[0.00]S[0.00]NIS[0.00]K_1 | 991.1295 | 3 | 29707 | 29714 | 66.0 | 93633900.0 | ||||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093590 | C3L-01455 | LUSC | Tumor_and_Normal | 88 | Male | White | Not-Hispanic or Latino | Lower Lobe | 5 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | United States | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | Staging Incomplete | NP_001025062.1(pre=R,post=D) | SYDVPPPPMEPDHPFYSNISK_S[50.00]Y[50.00]DVPPPPMEPDHPFY[0.00]S[0.00]NIS[0.00]K_1 | 991.1295 | 3 | 29707 | 29714 | 66.0 | 93633900.0 | ||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093591 | C3L-02624 | LUSC | Tumor_and_Normal | 63 | Male | Upper Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Bulgaria | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | NP_001025062.1(pre=R,post=D) | SYDVPPPPMEPDHPFYSNISK_S[50.00]Y[50.00]DVPPPPMEPDHPFY[0.00]S[0.00]NIS[0.00]K_1 | 991.1295 | 3 | 29707 | 29714 | 66.0 | 93633900.0 | ||||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093592 | C3N-03093 | LUSC | Tumor_and_Normal | 70 | Female | Squamous cell carcinoma | G3 Poorly differentiated | Ukraine | NP_001025062.1(pre=R,post=D) | SYDVPPPPMEPDHPFYSNISK_S[50.00]Y[50.00]DVPPPPMEPDHPFY[0.00]S[0.00]NIS[0.00]K_1 | 991.1295 | 3 | 29707 | 29714 | 66.0 | 93633900.0 | ||||||||||||||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f03.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6093593 | C3N-01893 | LUSC | Tumor_and_Normal | 70 | Male | Upper Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | Poland | Eighth Edition (2017) | pT3 | pN1 | pM0 | cM0 | NP_001025062.1(pre=R,post=D) | SYDVPPPPMEPDHPFYSNISK_S[50.00]Y[50.00]DVPPPPMEPDHPFY[0.00]S[0.00]NIS[0.00]K_1 | 991.1295 | 3 | 29707 | 29714 | 66.0 | 93633900.0 | ||||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820010 | C3L-02130 | LUSC | Tumor_and_Normal | 70 | Male | Upper Lobe | 3 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IB | Bulgaria | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | PAM | NP_001306872.1(pre=R,post=K) | peptidyl-glycine alpha-amidating monooxygenase isoform f precursor GN=PAM | GKGSGGLNLGNFFASR_GKGS[100.00]GGLNLGNFFAS[0.00]R_1 | 707.3742 | 3 | 35301 | 35306 | 80.0 | 2778180000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820011 | C3N-02675 | LUSC | Tumor_and_Normal | 69 | Male | Upper Lobe | 2 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | Poland | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | Staging Incomplete | REPS1 | NP_001273540.1(pre=R,post=M) | ralBP1-associated Eps domain-containing protein 1 isoform c GN=REPS1 | SSSSQTLTQFDSNIAPADPDTAIVHPVPIR_S[0.65]S[0.65]S[32.46]S[32.46]QT[32.46]LT[0.65]QFDS[0.65]NIAPADPDT[0.00]AIVHPVPIR_1 | 869.1841 | 4 | 35301 | 35307 | 113.0 | 3147730000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820012 | C3N-02523 | LUSC | Tumor_and_Normal | 61 | Male | White | Not-Hispanic or Latino | Lower Lobe | 2 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IA | United States | Eighth Edition (2017) | pT1b | pN0 | Not identified | cM0 | REPS1 | NP_001273540.1(pre=R,post=M) | ralBP1-associated Eps domain-containing protein 1 isoform c GN=REPS1 | SSSSQTLTQFDSNIAPADPDTAIVHPVPIR_S[0.65]S[0.65]S[32.46]S[32.46]QT[32.46]LT[0.65]QFDS[0.65]NIAPADPDT[0.00]AIVHPVPIR_1 | 869.1841 | 4 | 35301 | 35307 | 113.0 | 3147730000.0 | ||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820013 | C3N-02426 | LUSC | Tumor_and_Normal | 69 | Female | Lower Lobe | 2 | Other | G3 Poorly differentiated | Stage IA | China | Seventh Edition (2010) | pT1a | pN0 | Staging Incomplete | cM0 | REPS1 | NP_001273540.1(pre=R,post=M) | ralBP1-associated Eps domain-containing protein 1 isoform c GN=REPS1 | SSSSQTLTQFDSNIAPADPDTAIVHPVPIR_S[0.65]S[0.65]S[32.46]S[32.46]QT[32.46]LT[0.65]QFDS[0.65]NIAPADPDT[0.00]AIVHPVPIR_1 | 869.1841 | 4 | 35301 | 35307 | 113.0 | 3147730000.0 | ||||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2850419 | C3L-02163 | LUSC | Tumor_and_Normal | 57 | Male | Upper Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN1 | Staging Incomplete | Staging Incomplete | TBC1D16 | NP_061893.2(pre=K,post=R) | TBC1 domain family member 16 isoform a GN=TBC1D16 | LPSSETHPEESMYK_LPS[33.33]S[33.33]ET[33.33]HPEES[0.00]MY[0.00]K_1 | 730.3469 | 3 | 18197 | 18199 | 58.0 | 2033400000.0 | ||||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2850420 | C3L-00904 | LUSC | Tumor_and_Normal | 71 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIB | United States | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | TBC1D16 | NP_061893.2(pre=K,post=R) | TBC1 domain family member 16 isoform a GN=TBC1D16 | LPSSETHPEESMYK_LPS[33.33]S[33.33]ET[33.33]HPEES[0.00]MY[0.00]K_1 | 730.3469 | 3 | 18197 | 18199 | 58.0 | 2033400000.0 | ||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f05.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3475786 | C3N-04155 | LUSC | Tumor_and_Normal | 76 | Male | Middle Lobe | 3 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IA | Ukraine | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | CEP170B | NP_001106197.1(pre=R,post=G) | centrosomal protein of 170 kDa protein B isoform 1 GN=CEP170B | SPQEGPTWSR_S[100.00]PQEGPT[0.00]WS[0.00]R_1 | 727.335 | 2 | 19746 | 19752 | 104.0 | 411255000.0 | ||||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f05.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3475787 | C3N-01025 | LUSC | Tumor_and_Normal | 52 | Male | Other | 10 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIB | Vietnam | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | CEP170B | NP_001106197.1(pre=R,post=G) | centrosomal protein of 170 kDa protein B isoform 1 GN=CEP170B | SPQEGPTWSR_S[100.00]PQEGPT[0.00]WS[0.00]R_1 | 727.335 | 2 | 19746 | 19752 | 104.0 | 411255000.0 | ||||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f05.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3475788 | C3N-00221 | LUSC | Tumor_and_Normal | 78 | Male | Not Reported | Not-Hispanic or Latino | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage III | Other: TSS did not collect this information | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | CEP170B | NP_001106197.1(pre=R,post=G) | centrosomal protein of 170 kDa protein B isoform 1 GN=CEP170B | SPQEGPTWSR_S[100.00]PQEGPT[0.00]WS[0.00]R_1 | 727.335 | 2 | 19746 | 19752 | 104.0 | 411255000.0 | ||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f05.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3475789 | C3L-04013 | LUSC | Tumor_and_Normal | 61 | Male | Other | 8 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIB | Bulgaria | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | Staging Incomplete | CEP170B | NP_001106197.1(pre=R,post=G) | centrosomal protein of 170 kDa protein B isoform 1 GN=CEP170B | SPQEGPTWSR_S[100.00]PQEGPT[0.00]WS[0.00]R_1 | 727.335 | 2 | 19746 | 19752 | 104.0 | 411255000.0 | ||||||||||||||||||||||||||||||||||||
11CPTAC_LSCC_Phosphoproteome_BI_20190802 | 11CPTAC_LSCC_P_BI_20190802_BD_f05.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3475791 | C3N-04155 | LUSC | Tumor_and_Normal | 76 | Male | Middle Lobe | 3 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IA | Ukraine | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | MAGED2 | NP_055414.2(pre=K,post=D) | melanoma-associated antigen D2 GN=MAGED2 | LQSSQEPEAPPPR_LQS[1.59]S[98.41]QEPEAPPPR_1 | 872.9261 | 2 | 19746 | 19759 | 92.0 | 0.0 | ||||||||||||||||||||||||||||||||||||
22CPTAC_LSCC_Phosphoproteome_BI_20190907 | 22CPTAC_LSCC_P_BI_20190907_BD_f12.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4509626 | C3N-03851 | LUSC | Tumor_and_Normal | 44 | Male | Upper Lobe | 5 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIB | China | Eighth Edition (2017) | pT2b | pN1 | pM0 | cM0 | MAP3K11 | NP_002410.1(pre=R,post=R) | mitogen-activated protein kinase kinase kinase 11 GN=MAP3K11 | IDPWSFVSAGPRPSPLPSPQPAPR_IDPWS[0.00]FVS[0.00]AGPRPS[0.07]PLPS[99.92]PQPAPR_1 | 955.826 | 3 | 39096 | 39097 | 146.0 | 248761000.0 | ||||||||||||||||||||||||||||||||||||
22CPTAC_LSCC_Phosphoproteome_BI_20190907 | 22CPTAC_LSCC_P_BI_20190907_BD_f12.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4509627 | C3N-01892 | LUSC | Tumor_and_Normal | 77 | Male | Upper Lobe | 7 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Eighth Edition (2017) | pT3 | pN0 | pM0 | cM0 | MAP3K11 | NP_002410.1(pre=R,post=R) | mitogen-activated protein kinase kinase kinase 11 GN=MAP3K11 | IDPWSFVSAGPRPSPLPSPQPAPR_IDPWS[0.00]FVS[0.00]AGPRPS[0.07]PLPS[99.92]PQPAPR_1 | 955.826 | 3 | 39096 | 39097 | 146.0 | 248761000.0 | ||||||||||||||||||||||||||||||||||||
22CPTAC_LSCC_Phosphoproteome_BI_20190907 | 22CPTAC_LSCC_P_BI_20190907_BD_f12.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4509628 | C3L-03965 | LUSC | Tumor_and_Normal | 54 | Male | Other | 4 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | Bulgaria | Seventh Edition (2010) | pT2b | pN2 | Staging Incomplete | Staging Incomplete | MAP3K11 | NP_002410.1(pre=R,post=R) | mitogen-activated protein kinase kinase kinase 11 GN=MAP3K11 | IDPWSFVSAGPRPSPLPSPQPAPR_IDPWS[0.00]FVS[0.00]AGPRPS[0.07]PLPS[99.92]PQPAPR_1 | 955.826 | 3 | 39096 | 39097 | 146.0 | 248761000.0 | ||||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5585619 | C3L-01285 | LUSC | Tumor_and_Normal | 54 | Male | White | Not-Hispanic or Latino | Upper Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | United States | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | Staging Incomplete | LRRC8B | NP_001127948.1(pre=W,post=L) | volume-regulated anion channel subunit LRRC8B GN=LRRC8B | TTRALSETVAEQSVRPLK_T[92.33]T[92.33]RALS[7.67]ET[7.67]VAEQS[100.00]VRPLK_3 | 671.8353 | 4 | 51148 | 51153 | 52.0 | 0.0 | ||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5578341 | C3N-03662 | LUSC | Tumor_and_Normal | 64 | Male | Middle Lobe | 4 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | Ukraine | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | TTC9 | NP_056166.1(pre=R,post=L) | tetratricopeptide repeat protein 9A GN=TTC9 | DSRPASPAGALKPGR_DS[0.00]RPAS[100.00]PAGALKPGR_1 | 673.3696 | 3 | 14409 | 14413 | 50.0 | 2093940000.0 | ||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5578342 | C3N-03072 | LUSC | Tumor_and_Normal | 62 | Male | Upper Lobe | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | China | Eighth Edition (2017) | pT2a | pN2 | pM0 | cM0 | TTC9 | NP_056166.1(pre=R,post=L) | tetratricopeptide repeat protein 9A GN=TTC9 | DSRPASPAGALKPGR_DS[0.00]RPAS[100.00]PAGALKPGR_1 | 673.3696 | 3 | 14409 | 14413 | 50.0 | 2093940000.0 | ||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5578343 | C3N-02252 | LUSC | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Squamous cell carcinoma | G3 Poorly differentiated | Other: unknown | TTC9 | NP_056166.1(pre=R,post=L) | tetratricopeptide repeat protein 9A GN=TTC9 | DSRPASPAGALKPGR_DS[0.00]RPAS[100.00]PAGALKPGR_1 | 673.3696 | 3 | 14409 | 14413 | 50.0 | 2093940000.0 | ||||||||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5728686 | C3N-03662 | LUSC | Tumor_and_Normal | 64 | Male | Middle Lobe | 4 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | Ukraine | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | BPTF | NP_872579.2(pre=K,post=L) | nucleosome-remodeling factor subunit BPTF isoform 1 GN=BPTF | SLTSATSTSNIQSSASQPPRPQQGQVK_S[14.29]LT[14.29]S[14.29]AT[14.29]S[14.29]T[14.29]S[14.29]NIQS[0.00]S[0.00]AS[0.00]QPPRPQQGQVK_1 | 831.6792 | 4 | 19474 | 19477 | 115.0 | 292948000.0 | ||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5728687 | C3N-03072 | LUSC | Tumor_and_Normal | 62 | Male | Upper Lobe | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | China | Eighth Edition (2017) | pT2a | pN2 | pM0 | cM0 | BPTF | NP_872579.2(pre=K,post=L) | nucleosome-remodeling factor subunit BPTF isoform 1 GN=BPTF | SLTSATSTSNIQSSASQPPRPQQGQVK_S[14.29]LT[14.29]S[14.29]AT[14.29]S[14.29]T[14.29]S[14.29]NIQS[0.00]S[0.00]AS[0.00]QPPRPQQGQVK_1 | 831.6792 | 4 | 19474 | 19477 | 115.0 | 292948000.0 | ||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5728688 | C3N-02252 | LUSC | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Squamous cell carcinoma | G3 Poorly differentiated | Other: unknown | BPTF | NP_872579.2(pre=K,post=L) | nucleosome-remodeling factor subunit BPTF isoform 1 GN=BPTF | SLTSATSTSNIQSSASQPPRPQQGQVK_S[14.29]LT[14.29]S[14.29]AT[14.29]S[14.29]T[14.29]S[14.29]NIQS[0.00]S[0.00]AS[0.00]QPPRPQQGQVK_1 | 831.6792 | 4 | 19474 | 19477 | 115.0 | 292948000.0 | ||||||||||||||||||||||||||||||||||||||||||
04CPTAC_LSCC_Phosphoproteome_BI_20190705 | 04CPTAC_LSCC_P_BI_20190705_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5728702 | C3N-03072 | LUSC | Tumor_and_Normal | 62 | Male | Upper Lobe | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | China | Eighth Edition (2017) | pT2a | pN2 | pM0 | cM0 | PIK3AP1 | NP_689522.2(pre=R,post=V) | phosphoinositide 3-kinase adapter protein 1 GN=PIK3AP1 | SRSPGPPQVDGTPTMSLERPPR_S[50.00]RS[50.00]PGPPQVDGT[0.00]PT[0.00]MS[0.00]LERPPR_1 | 668.5831 | 4 | 19474 | 19478 | 139.0 | 770263000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2821013 | C3N-02426 | LUSC | Tumor_and_Normal | 69 | Female | Lower Lobe | 2 | Other | G3 Poorly differentiated | Stage IA | China | Seventh Edition (2010) | pT1a | pN0 | Staging Incomplete | cM0 | STOML1 | NP_004800.2(pre=R,post=G) | stomatin-like protein 1 isoform 1 GN=STOML1 | FQQSSFGFLGSQK_FQQS[2.13]S[95.74]FGFLGS[2.13]QK_1 | 667.0095 | 3 | 37000 | 37007 | 82.0 | 256585000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820938 | C3N-02426 | LUSC | Tumor_and_Normal | 69 | Female | Lower Lobe | 2 | Other | G3 Poorly differentiated | Stage IA | China | Seventh Edition (2010) | pT1a | pN0 | Staging Incomplete | cM0 | ACIN1 | NP_055792.1(pre=K,post=E) | apoptotic chromatin condensation inducer in the nucleus isoform 1 GN=ACIN1 | KASLVALPEQTASEEETPPPLLTK_KAS[100.00]LVALPEQT[0.00]AS[0.00]EEET[0.00]PPPLLT[0.00]K_1 | 829.9647 | 4 | 36853 | 36856 | 65.0 | 1685000000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820939 | C3N-02284 | LUSC | Tumor | 69 | Male | Mainstem bronchus | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Eighth Edition (2017) | pT3 | pN0 | pM0 | cM0 | ACIN1 | NP_055792.1(pre=K,post=E) | apoptotic chromatin condensation inducer in the nucleus isoform 1 GN=ACIN1 | KASLVALPEQTASEEETPPPLLTK_KAS[100.00]LVALPEQT[0.00]AS[0.00]EEET[0.00]PPPLLT[0.00]K_1 | 829.9647 | 4 | 36853 | 36856 | 65.0 | 1685000000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820940 | C3L-02130 | LUSC | Tumor_and_Normal | 70 | Male | Upper Lobe | 3 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IB | Bulgaria | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | ACIN1 | NP_055792.1(pre=K,post=E) | apoptotic chromatin condensation inducer in the nucleus isoform 1 GN=ACIN1 | KASLVALPEQTASEEETPPPLLTK_KAS[100.00]LVALPEQT[0.00]AS[0.00]EEET[0.00]PPPLLT[0.00]K_1 | 829.9647 | 4 | 36853 | 36856 | 65.0 | 1685000000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820941 | C3N-02675 | LUSC | Tumor_and_Normal | 69 | Male | Upper Lobe | 2 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | Poland | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | Staging Incomplete | ELF2 | NP_001317965.1(pre=K,post=V) | ETS-related transcription factor Elf-2 isoform 6 GN=ELF2 | ISTVAVQSVNAGAPLITSTSPTTATSPK_IS[0.00]T[0.00]VAVQS[0.00]VNAGAPLIT[0.00]S[0.00]T[0.00]S[0.00]PT[0.00]T[0.00]AT[0.09]S[99.91]PK_1 | 810.1934 | 4 | 36866 | 36868 | 70.0 | 351952000.0 | ||||||||||||||||||||||||||||||||||||
09CPTAC_LSCC_Phosphoproteome_BI_20190729 | 09CPTAC_LSCC_P_BI_20190729_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2820942 | C3N-02523 | LUSC | Tumor_and_Normal | 61 | Male | White | Not-Hispanic or Latino | Lower Lobe | 2 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IA | United States | Eighth Edition (2017) | pT1b | pN0 | Not identified | cM0 | ELF2 | NP_001317965.1(pre=K,post=V) | ETS-related transcription factor Elf-2 isoform 6 GN=ELF2 | ISTVAVQSVNAGAPLITSTSPTTATSPK_IS[0.00]T[0.00]VAVQS[0.00]VNAGAPLIT[0.00]S[0.00]T[0.00]S[0.00]PT[0.00]T[0.00]AT[0.09]S[99.91]PK_1 | 810.1934 | 4 | 36866 | 36868 | 70.0 | 351952000.0 | ||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2850869 | C3L-02163 | LUSC | Tumor_and_Normal | 57 | Male | Upper Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN1 | Staging Incomplete | Staging Incomplete | SRPRA | NP_003130.2(pre=I,post=G) | signal recognition particle receptor subunit alpha isoform 1 GN=SRPRA | RGTGSGGQLQDLDCSSSDDEGAAQNSTKPSATK_RGT[0.06]GS[0.06]GGQLQDLDCS[99.91]S[99.99]S[99.99]DDEGAAQNS[0.00]T[0.00]KPS[0.00]AT[0.00]K_3 | 1063.9722 | 4 | 18944 | 18945 | 108.0 | 2052010000.0 | ||||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5570682 | C3L-02627 | LUSC | Tumor_and_Normal | 64 | Female | Lower Lobe | 2 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Bulgaria | Seventh Edition (2010) | pT1 | pN0 | Staging Incomplete | cM0 | GAPDH | NP_001276674.1(pre=R,post=Y) | glyceraldehyde-3-phosphate dehydrogenase isoform 1 GN=GAPDH | VIISAPSADAPMFVMGVNHEK_VIIS[50.00]APS[50.00]ADAPMFVMGVNHEK_1 | 917.8068 | 3 | 38550 | 38556 | 71.0 | 8618450.0 | ||||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5570683 | C3L-02170 | LUSC | Tumor | 73 | Male | Lower Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IB | Bulgaria | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | Staging Incomplete | GAPDH | NP_001276674.1(pre=R,post=Y) | glyceraldehyde-3-phosphate dehydrogenase isoform 1 GN=GAPDH | VIISAPSADAPMFVMGVNHEK_VIIS[50.00]APS[50.00]ADAPMFVMGVNHEK_1 | 917.8068 | 3 | 38550 | 38556 | 71.0 | 8618450.0 | ||||||||||||||||||||||||||||||||||||
13CPTAC_LSCC_Phosphoproteome_BI_20190806 | 13CPTAC_LSCC_P_BI_20190806_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 5570684 | C3L-01285 | LUSC | Tumor_and_Normal | 54 | Male | White | Not-Hispanic or Latino | Upper Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | United States | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | Staging Incomplete | GAPDH | NP_001276674.1(pre=R,post=Y) | glyceraldehyde-3-phosphate dehydrogenase isoform 1 GN=GAPDH | VIISAPSADAPMFVMGVNHEK_VIIS[50.00]APS[50.00]ADAPMFVMGVNHEK_1 | 917.8068 | 3 | 38550 | 38556 | 71.0 | 8618450.0 | ||||||||||||||||||||||||||||||||||
14CPTAC_LSCC_Phosphoproteome_BI_20190809 | 14CPTAC_LSCC_P_BI_20190809_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 6976007 | C3N-03093 | LUSC | Tumor_and_Normal | 70 | Female | Squamous cell carcinoma | G3 Poorly differentiated | Ukraine | PGM2 | NP_060760.2(pre=K,post=Q) | phosphoglucomutase-2 GN=PGM2 | LCAGIMITASHNPK_LCAGIMIT[0.00]AS[100.00]HNPK_1 | 684.3563 | 3 | 26958 | 26959 | 84.0 | 251965000000.0 | ||||||||||||||||||||||||||||||||||||||||||||
10CPTAC_LSCC_Phosphoproteome_BI_20190731 | 10CPTAC_LSCC_P_BI_20190731_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3086863 | C3L-02951 | LUSC | Tumor_and_Normal | 61 | Male | White | Not-Hispanic or Latino | Lower Lobe | 5 | Non-keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIA | United States | Eighth Edition (2017) | pT2b | pN0 | No pathologic evidence of distant metastasis | unknown | MS4A1 | NP_068769.2(pre=R,post=E) | B-lymphocyte antigen CD20 GN=MS4A1 | RMSSLVGPTQSFFMR_RMS[100.00]S[100.00]LVGPT[0.00]QS[0.00]FFMR_2 | 716.9902 | 3 | 36438 | 36443 | 69.0 | 926960000.0 | ||||||||||||||||||||||||||||||||||
10CPTAC_LSCC_Phosphoproteome_BI_20190731 | 10CPTAC_LSCC_P_BI_20190731_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3086864 | C3L-02629 | LUSC | Tumor_and_Normal | 57 | Male | Lower Lobe | 8 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Bulgaria | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | MS4A1 | NP_068769.2(pre=R,post=E) | B-lymphocyte antigen CD20 GN=MS4A1 | RMSSLVGPTQSFFMR_RMS[100.00]S[100.00]LVGPT[0.00]QS[0.00]FFMR_2 | 716.9902 | 3 | 36438 | 36443 | 69.0 | 926960000.0 | ||||||||||||||||||||||||||||||||||||
10CPTAC_LSCC_Phosphoproteome_BI_20190731 | 10CPTAC_LSCC_P_BI_20190731_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3086865 | C3L-00923 | LUSC | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | United States | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | MS4A1 | NP_068769.2(pre=R,post=E) | B-lymphocyte antigen CD20 GN=MS4A1 | RMSSLVGPTQSFFMR_RMS[100.00]S[100.00]LVGPT[0.00]QS[0.00]FFMR_2 | 716.9902 | 3 | 36438 | 36443 | 69.0 | 926960000.0 | ||||||||||||||||||||||||||||||||||
10CPTAC_LSCC_Phosphoproteome_BI_20190731 | 10CPTAC_LSCC_P_BI_20190731_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 3086866 | C3N-04127 | LUSC | Tumor_and_Normal | 63 | Male | Lower Lobe | 5 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | China | Eighth Edition (2017) | pT2b | pN2 | pM0 | cM0 | LIMCH1 | NP_001317601.1(pre=R,post=Y) | LIM and calponin homology domains-containing protein 1 isoform h GN=LIMCH1 | SHSTEPNLSSFLNDPNPMK_S[0.86]HS[0.86]T[0.86]EPNLS[48.71]S[48.71]FLNDPNPMK_1 | 885.0961 | 3 | 36447 | 36448 | 90.0 | 8152030000.0 | ||||||||||||||||||||||||||||||||||||
12CPTAC_LSCC_Phosphoproteome_BI_20190804 | 12CPTAC_LSCC_P_BI_20190804_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4652778 | C3L-02660 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | Bulgaria | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | CTTN | NP_001171669.1(pre=K,post=A) | src substrate cortactin isoform c GN=CTTN | TQTPPVSPAPQPTEERLPSSPVYEDAASFK_T[33.33]QT[33.33]PPVS[33.33]PAPQPT[0.00]EERLPS[0.00]S[0.00]PVY[0.00]EDAAS[0.00]FK_1 | 941.9683 | 4 | 33106 | 33120 | 56.0 | 88379600000.0 | ||||||||||||||||||||||||||||||||||||
12CPTAC_LSCC_Phosphoproteome_BI_20190804 | 12CPTAC_LSCC_P_BI_20190804_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4652779 | C3L-02552 | LUSC | Tumor_and_Normal | 68 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Other | G3 Poorly differentiated | Stage IB | United States | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | CTTN | NP_001171669.1(pre=K,post=A) | src substrate cortactin isoform c GN=CTTN | TQTPPVSPAPQPTEERLPSSPVYEDAASFK_T[33.33]QT[33.33]PPVS[33.33]PAPQPT[0.00]EERLPS[0.00]S[0.00]PVY[0.00]EDAAS[0.00]FK_1 | 941.9683 | 4 | 33106 | 33120 | 56.0 | 88379600000.0 | ||||||||||||||||||||||||||||||||||
12CPTAC_LSCC_Phosphoproteome_BI_20190804 | 12CPTAC_LSCC_P_BI_20190804_BD_f10.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 4652780 | C3L-01884 | LUSC | Tumor_and_Normal | 74 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IA | United States | Seventh Edition (2010) | pT1b | pN0 | No pathologic evidence of distant metastasis | cM0 | CTTN | NP_001171669.1(pre=K,post=A) | src substrate cortactin isoform c GN=CTTN | TQTPPVSPAPQPTEERLPSSPVYEDAASFK_T[33.33]QT[33.33]PPVS[33.33]PAPQPT[0.00]EERLPS[0.00]S[0.00]PVY[0.00]EDAAS[0.00]FK_1 | 941.9683 | 4 | 33106 | 33120 | 56.0 | 88379600000.0 | ||||||||||||||||||||||||||||||||||
15CPTAC_LSCC_Phosphoproteome_BI_20190812 | 15CPTAC_LSCC_P_BI_20190812_BD_f06.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 1261813 | C3N-02283 | LUSC | Tumor | 67 | Male | Upper Lobe | 4 | Other | GX Grade cannot be assessed | Stage IIB | Poland | Eighth Edition (2017) | pT2b | pN1 | pM0 | cM0 | NP_001306115.1(pre=A,post=E) | GDLLEDSPKRPK_GDLLEDS[100]PKRPK_1 | 708.0682 | 3 | 19121 | 19124 | 52.0 | 2099660000.0 | ||||||||||||||||||||||||||||||||||||||
20CPTAC_LSCC_Phosphoproteome_BI_20190902 | 20CPTAC_LSCC_P_BI_20190902_BD_f07.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 744643 | C3L-04014 | LUSC | Tumor_and_Normal | 57 | Male | Lower Lobe | 2 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Bulgaria | Seventh Edition (2010) | pT1 | pN0 | Staging Incomplete | Staging Incomplete | TP53BP1 | NP_001135452.1(pre=R,post=G) | TP53-binding protein 1 isoform 1 GN=TP53BP1 | TSSGTSLSAMHSSGSSGK_T[19.93]S[19.93]S[19.93]GT[19.93]S[19.93]LS[0.36]AMHS[0.00]S[0.00]GS[0.00]S[0.00]GK_1 | 741.683 | 3 | 10204 | 10206 | 102.0 | 406297000.0 | ||||||||||||||||||||||||||||||||||||
20CPTAC_LSCC_Phosphoproteome_BI_20190902 | 20CPTAC_LSCC_P_BI_20190902_BD_f07.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 744644 | C3L-02891 | LUSC | Tumor_and_Normal | 66 | Female | White | Not-Hispanic or Latino | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | United States | Eighth Edition (2017) | pT1c | pN1 | unknown | unknown | TP53BP1 | NP_001135452.1(pre=R,post=G) | TP53-binding protein 1 isoform 1 GN=TP53BP1 | TSSGTSLSAMHSSGSSGK_T[19.93]S[19.93]S[19.93]GT[19.93]S[19.93]LS[0.36]AMHS[0.00]S[0.00]GS[0.00]S[0.00]GK_1 | 741.683 | 3 | 10204 | 10206 | 102.0 | 406297000.0 | ||||||||||||||||||||||||||||||||||
20CPTAC_LSCC_Phosphoproteome_BI_20190902 | 20CPTAC_LSCC_P_BI_20190902_BD_f07.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 744645 | C3L-00927 | LUSC | Tumor_and_Normal | 74 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G2 Moderately differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | TP53BP1 | NP_001135452.1(pre=R,post=G) | TP53-binding protein 1 isoform 1 GN=TP53BP1 | TSSGTSLSAMHSSGSSGK_T[19.93]S[19.93]S[19.93]GT[19.93]S[19.93]LS[0.36]AMHS[0.00]S[0.00]GS[0.00]S[0.00]GK_1 | 741.683 | 3 | 10204 | 10206 | 102.0 | 406297000.0 | ||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2953432 | C3N-03425 | LUSC | Tumor_and_Normal | 64 | Female | Upper Lobe | 3 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IB | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | MARF1 | NP_001171927.1(pre=R,post=E) | meiosis regulator and mRNA stability factor 1 isoform 2 GN=MARF1 | SKSPVGNPQLIQFSR_S[0.02]KS[99.98]PVGNPQLIQFS[0.00]R_1 | 732.7368 | 3 | 24915 | 24920 | 101.0 | 4303550000.0 | ||||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2953433 | C3N-00211 | LUSC | Tumor | 40 | Male | Middle Lobe | 5 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | Bulgaria | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | MARF1 | NP_001171927.1(pre=R,post=E) | meiosis regulator and mRNA stability factor 1 isoform 2 GN=MARF1 | SKSPVGNPQLIQFSR_S[0.02]KS[99.98]PVGNPQLIQFS[0.00]R_1 | 732.7368 | 3 | 24915 | 24920 | 101.0 | 4303550000.0 | ||||||||||||||||||||||||||||||||||||
21CPTAC_LSCC_Phosphoproteome_BI_20190905 | 21CPTAC_LSCC_P_BI_20190905_BD_f11.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 2953441 | C3N-04124 | LUSC | Tumor_and_Normal | 62 | Male | Upper Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | China | Eighth Edition (2017) | pT2a | pN0 | pM0 | cM0 | ZFC3H1 | NP_659419.3(pre=R,post=K) | zinc finger C3H1 domain-containing protein GN=ZFC3H1 | RISTSDILSEK_RIS[99.03]T[0.96]S[0.01]DILS[0.00]EK_1 | 596.3291 | 3 | 24915 | 24922 | 70.0 | 1647400000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371489 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | ZC3H18 | NP_001281269.1(pre=R,post=E) | zinc finger CCCH domain-containing protein 18 isoform 1 GN=ZC3H18 | GPTSSPCEEEGDEGEEDRTSDLRDEASSVTR_GPT[33.33]S[33.33]S[33.33]PCEEEGDEGEEDRT[4.33]S[95.67]DLRDEAS[0.00]S[0.00]VT[0.00]R_2 | 1262.85 | 3 | 19952 | 19953 | 52.0 | 638588000.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371490 | C3L-02648 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN0 | Staging Incomplete | Staging Incomplete | ZC3H18 | NP_001281269.1(pre=R,post=E) | zinc finger CCCH domain-containing protein 18 isoform 1 GN=ZC3H18 | GPTSSPCEEEGDEGEEDRTSDLRDEASSVTR_GPT[33.33]S[33.33]S[33.33]PCEEEGDEGEEDRT[4.33]S[95.67]DLRDEAS[0.00]S[0.00]VT[0.00]R_2 | 1262.85 | 3 | 19952 | 19953 | 52.0 | 638588000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371491 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | VAPB | NP_004729.1(pre=K,post=S) | vesicle-associated membrane protein-associated protein B/C isoform 1 GN=VAPB | TETPIVSK_T[0.00]ET[1.05]PIVS[98.95]K_1 | 706.8945 | 2 | 19952 | 19955 | 81.0 | 386726000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371492 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | VAPB | NP_004729.1(pre=K,post=S) | vesicle-associated membrane protein-associated protein B/C isoform 1 GN=VAPB | TETPIVSK_T[0.00]ET[1.05]PIVS[98.95]K_1 | 706.8945 | 2 | 19952 | 19955 | 81.0 | 386726000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371493 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | VAPB | NP_004729.1(pre=K,post=S) | vesicle-associated membrane protein-associated protein B/C isoform 1 GN=VAPB | TETPIVSK_T[0.00]ET[1.05]PIVS[98.95]K_1 | 706.8945 | 2 | 19952 | 19955 | 81.0 | 386726000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371494 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | VAPB | NP_004729.1(pre=K,post=S) | vesicle-associated membrane protein-associated protein B/C isoform 1 GN=VAPB | TETPIVSK_T[0.00]ET[1.05]PIVS[98.95]K_1 | 706.8945 | 2 | 19952 | 19955 | 81.0 | 386726000.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 371552 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | NP_000692.2(pre=R,post=T) | GIVVYTGDR_GIVVY[99.98]T[0.02]GDR_1 | 644.8302 | 2 | 20013 | 20014 | 85.0 | 722491000.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 372486 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | CAMK2D | NP_001212.2(pre=K,post=A) | calcium/calmodulin-dependent protein kinase type II subunit delta isoform 3 GN=CAMK2D | KPDGVKESTESSNTTIEDEDVK_KPDGVKES[49.12]T[49.12]ES[33.15]S[33.15]NT[1.76]T[33.70]IEDEDVK_2 | 1162.2462 | 3 | 21073 | 21076 | 55.0 | 2541270.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 373492 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | SAFB | NP_001188267.1(pre=K,post=V) | scaffold attachment factor B1 isoform 1 GN=SAFB | RSVVSFDK_RS[0.00]VVS[100.00]FDK_1 | 738.4034 | 2 | 22420 | 22422 | 86.0 | 213293000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 374486 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | SSRP1 | NP_003137.1(pre=K,post=M) | FACT complex subunit SSRP1 GN=SSRP1 | EGMNPSYDEYADSDEDQHDAYLER_EGMNPS[2.50]Y[2.50]DEY[95.00]ADS[100.00]DEDQHDAY[0.00]LER_2 | 1080.0767 | 3 | 23725 | 23728 | 96.0 | 221540000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 374487 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | SSRP1 | NP_003137.1(pre=K,post=M) | FACT complex subunit SSRP1 GN=SSRP1 | EGMNPSYDEYADSDEDQHDAYLER_EGMNPS[2.50]Y[2.50]DEY[95.00]ADS[100.00]DEDQHDAY[0.00]LER_2 | 1080.0767 | 3 | 23725 | 23728 | 96.0 | 221540000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 374488 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | SSRP1 | NP_003137.1(pre=K,post=M) | FACT complex subunit SSRP1 GN=SSRP1 | EGMNPSYDEYADSDEDQHDAYLER_EGMNPS[2.50]Y[2.50]DEY[95.00]ADS[100.00]DEDQHDAY[0.00]LER_2 | 1080.0767 | 3 | 23725 | 23728 | 96.0 | 221540000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 376487 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | NASP | NP_002473.2(pre=K,post=A) | nuclear autoantigenic sperm protein isoform 2 GN=NASP | QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR_QEPEVNGGS[2.30]GDAVPS[95.40]GNEVS[2.30]ENMEEEAENQAES[0.00]R_1 | 1295.5609 | 3 | 26229 | 26246 | 107.0 | 53943900.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 376488 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | NASP | NP_002473.2(pre=K,post=A) | nuclear autoantigenic sperm protein isoform 2 GN=NASP | QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR_QEPEVNGGS[2.30]GDAVPS[95.40]GNEVS[2.30]ENMEEEAENQAES[0.00]R_1 | 1295.5609 | 3 | 26229 | 26246 | 107.0 | 53943900.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 376489 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | NASP | NP_002473.2(pre=K,post=A) | nuclear autoantigenic sperm protein isoform 2 GN=NASP | QEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR_QEPEVNGGS[2.30]GDAVPS[95.40]GNEVS[2.30]ENMEEEAENQAES[0.00]R_1 | 1295.5609 | 3 | 26229 | 26246 | 107.0 | 53943900.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 379474 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | KDM2A | NP_036440.1(pre=R,post=G) | lysine-specific demethylase 2A isoform a GN=KDM2A | SCDEPLTPPPHSPTSMLQLIHDPVSPR_S[50.37]CDEPLT[50.37]PPPHS[33.06]PT[33.10]S[33.10]MLQLIHDPVS[0.00]PR_2 | 1138.5238 | 3 | 29887 | 29900 | 41.0 | 311177000.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 379475 | C3L-02648 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN0 | Staging Incomplete | Staging Incomplete | KDM2A | NP_036440.1(pre=R,post=G) | lysine-specific demethylase 2A isoform a GN=KDM2A | SCDEPLTPPPHSPTSMLQLIHDPVSPR_S[50.37]CDEPLT[50.37]PPPHS[33.06]PT[33.10]S[33.10]MLQLIHDPVS[0.00]PR_2 | 1138.5238 | 3 | 29887 | 29900 | 41.0 | 311177000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 379476 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | KDM2A | NP_036440.1(pre=R,post=G) | lysine-specific demethylase 2A isoform a GN=KDM2A | SCDEPLTPPPHSPTSMLQLIHDPVSPR_S[50.37]CDEPLT[50.37]PPPHS[33.06]PT[33.10]S[33.10]MLQLIHDPVS[0.00]PR_2 | 1138.5238 | 3 | 29887 | 29900 | 41.0 | 311177000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381468 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | DACT3 | NP_659493.2(pre=R,post=L) | dapper homolog 3 isoform 1 GN=DACT3 | AWASSWESEAAPEPAAPPAAPSPPDSPAEGR_AWAS[0.00]S[0.00]WES[0.00]EAAPEPAAPPAAPS[100.00]PPDS[0.00]PAEGR_1 | 1132.5197 | 3 | 32616 | 32620 | 97.0 | 407235000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381469 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | DACT3 | NP_659493.2(pre=R,post=L) | dapper homolog 3 isoform 1 GN=DACT3 | AWASSWESEAAPEPAAPPAAPSPPDSPAEGR_AWAS[0.00]S[0.00]WES[0.00]EAAPEPAAPPAAPS[100.00]PPDS[0.00]PAEGR_1 | 1132.5197 | 3 | 32616 | 32620 | 97.0 | 407235000.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381470 | C3L-02648 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN0 | Staging Incomplete | Staging Incomplete | DACT3 | NP_659493.2(pre=R,post=L) | dapper homolog 3 isoform 1 GN=DACT3 | AWASSWESEAAPEPAAPPAAPSPPDSPAEGR_AWAS[0.00]S[0.00]WES[0.00]EAAPEPAAPPAAPS[100.00]PPDS[0.00]PAEGR_1 | 1132.5197 | 3 | 32616 | 32620 | 97.0 | 407235000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381471 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | NP_001002858.1(pre=K,post=G) | SLYYYIQQDTK_S[25.00]LY[25.00]Y[25.00]Y[25.00]IQQDT[0.01]K_1 | 654.0022 | 3 | 32632 | 32633 | 68.0 | 388644000.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381472 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | NP_001002858.1(pre=K,post=G) | SLYYYIQQDTK_S[25.00]LY[25.00]Y[25.00]Y[25.00]IQQDT[0.01]K_1 | 654.0022 | 3 | 32632 | 32633 | 68.0 | 388644000.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 381473 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | NP_001002858.1(pre=K,post=G) | SLYYYIQQDTK_S[25.00]LY[25.00]Y[25.00]Y[25.00]IQQDT[0.01]K_1 | 654.0022 | 3 | 32632 | 32633 | 68.0 | 388644000.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 383456 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | UBAP2L | NP_055662.3(pre=K,post=T) | ubiquitin-associated protein 2-like isoform a GN=UBAP2L | GGSTTGSQFLEQFK_GGS[0.03]T[0.03]T[1.49]GS[98.46]QFLEQFK_1 | 1013.0088 | 2 | 35656 | 35662 | 75.0 | 8029940.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 384542 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | ZC3H11A | NP_001306167.1(pre=I,post=T) | zinc finger CCCH domain-containing protein 11A isoform 1 GN=ZC3H11A | NAADDDEDDDDQFSEEGDETK_NAADDDEDDDDQFS[100.00]EEGDET[0.00]K_1 | 966.7138 | 3 | 18334 | 18338 | 72.0 | 346275000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 385530 | C3L-02648 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN0 | Staging Incomplete | Staging Incomplete | ELF3 | NP_001107781.1(pre=K,post=T) | ETS-related transcription factor Elf-3 GN=ELF3 | ASWLGEQPQFWSK_AS[100.00]WLGEQPQFWS[0.00]K_1 | 701.3548 | 3 | 40773 | 40785 | 66.0 | 5604690.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 385531 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | APOA4 | NP_000473.2(pre=K,post=L) | apolipoprotein A-IV precursor GN=APOA4 | SELTQQLNALFQDK__0 | 698.3936 | 3 | 40786 | 40793 | 75.0 | 16344300.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 385532 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | APOA4 | NP_000473.2(pre=K,post=L) | apolipoprotein A-IV precursor GN=APOA4 | SELTQQLNALFQDK__0 | 698.3936 | 3 | 40786 | 40793 | 75.0 | 16344300.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 385533 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | APOA4 | NP_000473.2(pre=K,post=L) | apolipoprotein A-IV precursor GN=APOA4 | SELTQQLNALFQDK__0 | 698.3936 | 3 | 40786 | 40793 | 75.0 | 16344300.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 386532 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | PARP4 | NP_006428.2(pre=R,post=C) | poly [ADP-ribose] polymerase 4 GN=PARP4 | TTPVDLCLLEESVGSLEGSR_T[0.00]T[0.00]PVDLCLLEES[0.00]VGS[100.00]LEGS[0.00]R_1 | 824.4017 | 3 | 43941 | 43948 | 80.0 | 105530000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 387529 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | HEXDC | NP_001317471.1(pre=R,post=-) | hexosaminidase D isoform 2 GN=HEXDC | LQALLQDLSEVSAPPLPPTSPGRDVAQDP_LQALLQDLS[0.00]EVS[0.00]APPLPPT[50.00]S[50.00]PGRDVAQDP_1 | 1107.5739 | 3 | 47423 | 47436 | 43.0 | 6286880.0 | ||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f01.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 387530 | C3L-02648 | LUSC | Tumor_and_Normal | 72 | Male | Other | 3 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIA | Bulgaria | Seventh Edition (2010) | pT2 | pN0 | Staging Incomplete | Staging Incomplete | HEXDC | NP_001317471.1(pre=R,post=-) | hexosaminidase D isoform 2 GN=HEXDC | LQALLQDLSEVSAPPLPPTSPGRDVAQDP_LQALLQDLS[0.00]EVS[0.00]APPLPPT[50.00]S[50.00]PGRDVAQDP_1 | 1107.5739 | 3 | 47423 | 47436 | 43.0 | 6286880.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 388527 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | NUCKS1 | NP_073568.2(pre=K,post=E) | nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 GN=NUCKS1 | DDSHSAEDSEDEK_DDS[0.00]HS[0.05]AEDS[99.95]EDEK_1 | 667.9486 | 3 | 8620 | 8635 | 55.0 | 1027830000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 388528 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | NUCKS1 | NP_073568.2(pre=K,post=E) | nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 GN=NUCKS1 | DDSHSAEDSEDEK_DDS[0.00]HS[0.05]AEDS[99.95]EDEK_1 | 667.9486 | 3 | 8620 | 8635 | 55.0 | 1027830000.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 390526 | C3N-01194 | LUSC | Tumor_and_Normal | 69 | Male | Lower Lobe | 4 | Non-keratinizing squamous cell carcinoma | G3 Poorly differentiated | Stage IA | Poland | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | NP_001245257.1(pre=A,post=E) | SGSHSGSEEQLEATAR_S[1.91]GS[1.91]HS[96.19]GS[100.00]EEQLEAT[0.00]AR_2 | 678.952 | 3 | 12968 | 12974 | 85.0 | 82246700.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 390527 | C3N-01020 | LUSC | Tumor_and_Normal | 65 | Male | Other | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IB | Vietnam | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | NP_001245257.1(pre=A,post=E) | SGSHSGSEEQLEATAR_S[1.91]GS[1.91]HS[96.19]GS[100.00]EEQLEAT[0.00]AR_2 | 678.952 | 3 | 12968 | 12974 | 85.0 | 82246700.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 390528 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | NP_001245257.1(pre=A,post=E) | SGSHSGSEEQLEATAR_S[1.91]GS[1.91]HS[96.19]GS[100.00]EEQLEAT[0.00]AR_2 | 678.952 | 3 | 12968 | 12974 | 85.0 | 82246700.0 | ||||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 390529 | C3L-03678 | LUSC | Tumor | 49 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Squamous cell carcinoma | G3 Poorly differentiated | Stage IIIA | United States | Seventh Edition (2010) | pT2a | pN2 | No pathologic evidence of distant metastasis | cM0 | NP_001245257.1(pre=A,post=E) | SGSHSGSEEQLEATAR_S[1.91]GS[1.91]HS[96.19]GS[100.00]EEQLEAT[0.00]AR_2 | 678.952 | 3 | 12968 | 12974 | 85.0 | 82246700.0 | ||||||||||||||||||||||||||||||||||||
19CPTAC_LSCC_Phosphoproteome_BI_20190831 | 19CPTAC_LSCC_P_BI_20190831_BD_f02.raw | CPTAC_Phosphoproteome | 20200812 | 20221201 | 391528 | C3N-00497 | LUSC | Tumor_and_Normal | 64 | Female | Middle Lobe | 5 | Keratinizing squamous cell carcinoma | G2 Moderately differentiated | Stage IIB | Poland | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | RANBP3 | NP_015561.1(pre=R,post=E) | ran-binding protein 3 isoform RANBP3-d GN=RANBP3 | ENAAAESGSESSSQEATPEK_ENAAAES[20.00]GS[20.00]ES[20.00]S[20.00]S[20.00]QEAT[100.00]PEK_2 | 876.3731 | 3 | 14262 | 14265 | 57.0 | 101510000.0 |
판매제공처 홈페이지 | 판매담당자 | 연락처 | 이메일 |
---|---|---|---|
www.cellkey.co.kr | 셀키 | 0507-1387-0260 | sylee@cellkey.co.kr |
제약 및 취소/환불 규정 안내 |
---|
데이터 상품은 디지털화된 상품의 특성상 반품, 취소, 환불 되지 않으나 데이터의 심각한 오류, 상이한 데이터에 한하여 구매자가 요구하는 경우 환불을 진행할 수 있습니다. |