[감염병연구] |
폐질환·폐암(선암) 환자 의료 및 인산화단백체 데이터 폐질환·폐암(선암) 환자 의료 및 인산화단백체 데이터
|
데이터 기본 이용료
|
데이터등록일 | 데이터 수정일 | 데이터 이용기한 | 판매제공처 |
---|---|---|---|
2022-12-16 | 2023-07-05 | 무기한 | 셀키 |
데이터 제공포맷 | 데이터 제공방식 | 데이터 파일용량 | 데이터 상품구분 |
csv/zip | 다운로드 | 5.06 GB | dataset |
● 데이터 상품명 폐질환·폐암(선암) 환자 의료 및 인산화단백체 데이터 ● 데이터 상품 부제 암 특화 임상 및 인산화단백체 데이터와 의료데이터 ● 데이터 상품 요약 미국 국립암연구소 (NCI), 가톨릭대학교 의과대학의 폐질환·폐암(선암) 의료 및 인산화단백체 정성·정량 분석 결롸 ● 데이터 상품 정보 ■ 상품 설명 및 특징 - 국내 최초·최대 암 관련 (관련 질병 포함) 당 단백질 질량분석 실험 데이터의 해석 및 당·단백질 리포지토리를 구축하고 정밀의료 연구기술에 발전시키고자 함 - 참여 병원으로부터 제공된 폐질환 폐암(선암) 환자 시료를 전처리하여 고분해능 질량분석기기를 통해 최적화된 분석을 진행하고 당사에서 자체 개발한 분석솔루션 SpAC9 Pipeline을 활용하여 데이터분석 등의 프로세스를 통하여 표준화 기준에 맞춰 최종 데이터를 가공, 생산함 - NCI 의 CPTAC에서 제공된 질량분석이 완료된 선암 RAW 데이터는 SpAC9 Pipeline을 활용하여 재분석하고 표준화 기준에 맞춰 데이터를 가공·생산함 ■ 기간 및 범위 - 2022년 9월 ~ 2022년 10월 ■ 컬럼(속성) 정보 - 집계시작년월 : 2022년 9월 - 집계시작년월 : 2022년 10월 ■ 약어/전문용어 설명 - NCI: National Cancer Institute - CPTAC: Clinical Proteome Tumor Analysis Consortium ■ 활용 예제 - 시스템 확대·발전 - 의료 및 단백체 빅데이터 고도화를 위한 유전단백체 변이 아틀라스 구축으로 시스템 확대 및 발전 - 인간의 유전단백체 변이 아틀라스를 구축하여 질병 별로 유전자 변이가 단백질의 변이를 일으키는 경우의 데이터베이스 구축하여 질병의 이해와 개인 맞춤형 신약 개발 및 진단 발굴 사업에 필요한 데이터를 제공
그룹명
|
결과파일명
|
결과ID
|
질량분석기기분석일자
|
생성일자
|
수정일자
|
ID
|
환자ID
|
샘플ID
|
암코드
|
분석정보
|
샘플타입
|
환자나이
|
환자성별
|
환자인종
|
환자민족인종
|
환자종양위치
|
환자종양크기
|
병리학적종양타입명
|
병리학적종양등급
|
종양병소
|
종양측향화
|
병리학적병기분류
|
환자국적
|
종양괴사
|
병리학적진단
|
종양분화도
|
간경변병력
|
간결절크기
|
간염병력
|
B형간염표면항원
|
B형간염코어항체
|
프로트롬빈함량
|
빌리루빈함량
|
알부민함량
|
알라닌아미노전이효소함량
|
감마글루타밀전이효소함량
|
알파태아단백질함량
|
아스파르테이트아미노전달효소함량
|
알칼리인산분해효소함량
|
TNM병기분류
|
BCLC병기분류
|
AJCC병기분류
|
원발성종양병리학적상태
|
림프절전이병리학적상태
|
타장기전이병리학적상태
|
종양전이범위
|
암진단이력
|
치료이력
|
잔여종양병리학적상태
|
음주량
|
흡연이력
|
흡연나이
|
금연나이
|
하루흡연량
|
연간흡연량
|
12개월간종양크기
|
24개월간종양크기
|
유전자심볼
|
단백질심볼
|
단백질명
|
펩타이드명
|
펩타이드질량
|
펩타이드전하
|
펩타이드스캔1ID
|
펩타이드스캔2ID
|
펩타이드값
|
펩타이드함량
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2013863 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | RPTOR | NP_065812.1(pre=K,post=D) | regulatory-associated protein of mTOR isoform 1 GN=RPTOR | NYALPSPATTEGGSLTPVR_NY[0.07]ALPS[99.92]PAT[0.00]T[0.00]EGGS[0.00]LT[0.00]PVR_1 | 747.373 | 3 | 27520 | 27529 | 88.0 | 2662730000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2013864 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | KRT18 | NP_000215.1(pre=R,post=E) | keratin, type I cytoskeletal 18 GN=KRT18 | STSFRGGMGSGGLATGIAGGLAGMGGIQNEK_S[1.72]T[1.72]S[1.72]FRGGMGS[47.43]GGLAT[47.43]GIAGGLAGMGGIQNEK_1 | 853.1722 | 4 | 27533 | 27544 | 76.0 | 5142710000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2013865 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | KRT18 | NP_000215.1(pre=R,post=E) | keratin, type I cytoskeletal 18 GN=KRT18 | STSFRGGMGSGGLATGIAGGLAGMGGIQNEK_S[1.72]T[1.72]S[1.72]FRGGMGS[47.43]GGLAT[47.43]GIAGGLAGMGGIQNEK_1 | 853.1722 | 4 | 27533 | 27544 | 76.0 | 5142710000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2013866 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | KRT18 | NP_000215.1(pre=R,post=E) | keratin, type I cytoskeletal 18 GN=KRT18 | STSFRGGMGSGGLATGIAGGLAGMGGIQNEK_S[1.72]T[1.72]S[1.72]FRGGMGS[47.43]GGLAT[47.43]GIAGGLAGMGGIQNEK_1 | 853.1722 | 4 | 27533 | 27544 | 76.0 | 5142710000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2014864 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | AHNAK | NP_001333374.1(pre=K,post=M) | neuroblast differentiation-associated protein AHNAK isoform 1 GN=AHNAK | VDINTPDVDVHGPDWHLK_VDINT[100]PDVDVHGPDWHLK_1 | 649.5823 | 4 | 28411 | 28418 | 116.0 | 21422400000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2014865 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | FAM83H | NP_940890.3(pre=R,post=D) | protein FAM83H GN=FAM83H | LSSATANALYSSNLR_LS[1.55]S[96.91]AT[1.55]ANALY[0.00]S[0.00]S[0.00]NLR_1 | 938.9698 | 2 | 28425 | 28429 | 100.0 | 999438000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2014866 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | FAM83H | NP_940890.3(pre=R,post=D) | protein FAM83H GN=FAM83H | LSSATANALYSSNLR_LS[1.55]S[96.91]AT[1.55]ANALY[0.00]S[0.00]S[0.00]NLR_1 | 938.9698 | 2 | 28425 | 28429 | 100.0 | 999438000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2015883 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | SNTB2 | NP_006741.1(pre=R,post=T) | beta-2-syntrophin GN=SNTB2 | SPSLGSDLTFATR_S[1.24]PS[98.76]LGS[0.00]DLT[0.00]FAT[0.00]R_1 | 830.9132 | 2 | 29618 | 29622 | 123.0 | 2334250000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2016887 | C3N-01030 | C3N.01030.N | LUAD | 127N | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | BIN2 | NP_057377.3(pre=R,post=S) | bridging integrator 2 isoform 1 GN=BIN2 | TATVSSPLTSPTSPSTLSLK_T[0.00]AT[0.00]VS[0.00]S[0.00]PLT[0.00]S[0.00]PT[0.00]S[0.00]PS[0.00]T[0.00]LS[100.00]LK_1 | 838.4595 | 3 | 30526 | 30530 | 61.0 | 485011000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2017886 | C3N-00294 | C3N.00294 | LUAD | 130C | Tumor | 57 | Male | Lower Lobe | 6 | Adenocarcinoma | GX Grade cannot be assessed | Unifocal | Right | Stage IIB | Poland | Not identified | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | No | PCNT | NP_006022.3(pre=K,post=S) | pericentrin isoform 1 GN=PCNT | NWDSLIPDEMPDSPIQEK_NWDS[0.00]LIPDEMPDS[100.00]PIQEK_1 | 1326.6404 | 2 | 39454 | 39465 | 96.0 | 513140000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2018884 | C3N-00556 | C3N.00556.N | LUAD | 130N | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | PARP4 | NP_006428.2(pre=K,post=Y) | poly [ADP-ribose] polymerase 4 GN=PARP4 | TEGLCPDSATEEEDTVELTEFGMQNVEIPHLPQDFEVAK_T[47.03]EGLCPDS[47.03]AT[1.98]EEEDT[1.98]VELT[1.98]EFGMQNVEIPHLPQDFEVAK_1 | 1240.5929 | 4 | 40341 | 40343 | 57.0 | 1712400000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2018885 | C3N-00556 | C3N.00556 | LUAD | 129C | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | PARP4 | NP_006428.2(pre=K,post=Y) | poly [ADP-ribose] polymerase 4 GN=PARP4 | TEGLCPDSATEEEDTVELTEFGMQNVEIPHLPQDFEVAK_T[47.03]EGLCPDS[47.03]AT[1.98]EEEDT[1.98]VELT[1.98]EFGMQNVEIPHLPQDFEVAK_1 | 1240.5929 | 4 | 40341 | 40343 | 57.0 | 1712400000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2019881 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | RICTOR | NP_001272368.1(pre=R,post=E) | rapamycin-insensitive companion of mTOR isoform 2 GN=RICTOR | ILAPYTDFHYRHSPDTAEGQLK_ILAPY[0.00]T[0.00]DFHY[0.09]RHS[97.09]PDT[2.82]AEGQLK_1 | 775.1439 | 4 | 26153 | 26157 | 83.0 | 599127000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2019882 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | ALB | NP_000468.1(pre=K,post=N) | serum albumin preproprotein GN=ALB | KVPQVSTPTLVEVSR_KVPQVS[98.44]T[1.56]PT[0.00]LVEVS[0.00]R_1 | 726.748 | 3 | 26158 | 26159 | 118.0 | 2360890000.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2020885 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | PRUNE1 | NP_067045.1(pre=R,post=L) | exopolyphosphatase PRUNE1 isoform 1 GN=PRUNE1 | ASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK_AS[0.01]NS[0.01]LIS[0.11]GLS[0.11]QDEEDPPLPPT[49.88]PMNS[49.88]LVDECPLDQGLPK_1 | 923.8498 | 5 | 42393 | 42405 | 39.0 | 61512800.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2020886 | C3N-02158 | C3N.02158.N | LUAD | 128N | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | PRUNE1 | NP_067045.1(pre=R,post=L) | exopolyphosphatase PRUNE1 isoform 1 GN=PRUNE1 | ASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK_AS[0.01]NS[0.01]LIS[0.11]GLS[0.11]QDEEDPPLPPT[49.88]PMNS[49.88]LVDECPLDQGLPK_1 | 923.8498 | 5 | 42393 | 42405 | 39.0 | 61512800.0 | |||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2020887 | C3N-02158 | C3N.02158 | LUAD | 127C | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | PRUNE1 | NP_067045.1(pre=R,post=L) | exopolyphosphatase PRUNE1 isoform 1 GN=PRUNE1 | ASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK_AS[0.01]NS[0.01]LIS[0.11]GLS[0.11]QDEEDPPLPPT[49.88]PMNS[49.88]LVDECPLDQGLPK_1 | 923.8498 | 5 | 42393 | 42405 | 39.0 | 61512800.0 | |||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2020888 | C3N-00704 | C3N.00704.N | LUAD | 127N | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | No | PRUNE1 | NP_067045.1(pre=R,post=L) | exopolyphosphatase PRUNE1 isoform 1 GN=PRUNE1 | ASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK_AS[0.01]NS[0.01]LIS[0.11]GLS[0.11]QDEEDPPLPPT[49.88]PMNS[49.88]LVDECPLDQGLPK_1 | 923.8498 | 5 | 42393 | 42405 | 39.0 | 61512800.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2020889 | C3N-00704 | C3N.00704 | LUAD | 126 | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | No | PRUNE1 | NP_067045.1(pre=R,post=L) | exopolyphosphatase PRUNE1 isoform 1 GN=PRUNE1 | ASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK_AS[0.01]NS[0.01]LIS[0.11]GLS[0.11]QDEEDPPLPPT[49.88]PMNS[49.88]LVDECPLDQGLPK_1 | 923.8498 | 5 | 42393 | 42405 | 39.0 | 61512800.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2021879 | C3N-00294 | C3N.00294 | LUAD | 130C | Tumor | 57 | Male | Lower Lobe | 6 | Adenocarcinoma | GX Grade cannot be assessed | Unifocal | Right | Stage IIB | Poland | Not identified | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | No | RAD54L2 | NP_001309182.1(pre=P,post=E) | helicase ARIP4 isoform a GN=RAD54L2 | DPEGLARPVSPDSPEIISELQQYADVAAAR_DPEGLARPVS[97.50]PDS[2.49]PEIIS[0.00]ELQQY[0.00]ADVAAAR_1 | 1168.5894 | 3 | 43651 | 43653 | 89.0 | 657799000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2021880 | C3N-00556 | C3N.00556.N | LUAD | 130N | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | RAD54L2 | NP_001309182.1(pre=P,post=E) | helicase ARIP4 isoform a GN=RAD54L2 | DPEGLARPVSPDSPEIISELQQYADVAAAR_DPEGLARPVS[97.50]PDS[2.49]PEIIS[0.00]ELQQY[0.00]ADVAAAR_1 | 1168.5894 | 3 | 43651 | 43653 | 89.0 | 657799000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2022870 | C3N-00556 | C3N.00556 | LUAD | 129C | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | XXX_NP_001004733.1(pre=K,post=L) | KFASKVEKNRLSYVLPN_KFAS[33.33]KVEKNRLS[33.33]Y[33.33]VLPN_1 | 1495.3936 | 2 | 44965 | 44969 | 22.0 | 0.0 | ||||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2022871 | C3N-02421 | C3N.02421.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | XXX_NP_001004733.1(pre=K,post=L) | KFASKVEKNRLSYVLPN_KFAS[33.33]KVEKNRLS[33.33]Y[33.33]VLPN_1 | 1495.3936 | 2 | 44965 | 44969 | 22.0 | 0.0 | ||||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2022872 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | XXX_NP_001004733.1(pre=K,post=L) | KFASKVEKNRLSYVLPN_KFAS[33.33]KVEKNRLS[33.33]Y[33.33]VLPN_1 | 1495.3936 | 2 | 44965 | 44969 | 22.0 | 0.0 | ||||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2023866 | C3N-00704 | C3N.00704 | LUAD | 126 | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | No | YAP1 | NP_001269030.1(pre=R,post=T) | transcriptional coactivator YAP1 isoform 9 GN=YAP1 | GDSETDLEALFNAVMNPK_GDS[99.94]ET[0.06]DLEALFNAVMNPK_1 | 835.7414 | 3 | 46137 | 46138 | 83.0 | 553579000.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2023867 | C3N-00294 | C3N.00294 | LUAD | 130C | Tumor | 57 | Male | Lower Lobe | 6 | Adenocarcinoma | GX Grade cannot be assessed | Unifocal | Right | Stage IIB | Poland | Not identified | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | No | ACBD3 | NP_073572.2(pre=R,post=G) | Golgi resident protein GCP60 GN=ACBD3 | LEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGR_LEVS[48.71]VDGLT[48.71]LS[2.58]PDPEERPGAEGAPLLPPPLPPPS[99.98]PPGS[0.02]GR_2 | 1096.802 | 4 | 46154 | 46157 | 34.0 | 6958950000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2023868 | C3N-00556 | C3N.00556.N | LUAD | 130N | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | ACBD3 | NP_073572.2(pre=R,post=G) | Golgi resident protein GCP60 GN=ACBD3 | LEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGR_LEVS[48.71]VDGLT[48.71]LS[2.58]PDPEERPGAEGAPLLPPPLPPPS[99.98]PPGS[0.02]GR_2 | 1096.802 | 4 | 46154 | 46157 | 34.0 | 6958950000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2023869 | C3N-00556 | C3N.00556 | LUAD | 129C | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | ACBD3 | NP_073572.2(pre=R,post=G) | Golgi resident protein GCP60 GN=ACBD3 | LEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGR_LEVS[48.71]VDGLT[48.71]LS[2.58]PDPEERPGAEGAPLLPPPLPPPS[99.98]PPGS[0.02]GR_2 | 1096.802 | 4 | 46154 | 46157 | 34.0 | 6958950000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2023870 | C3N-02421 | C3N.02421.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | ACBD3 | NP_073572.2(pre=R,post=G) | Golgi resident protein GCP60 GN=ACBD3 | LEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGR_LEVS[48.71]VDGLT[48.71]LS[2.58]PDPEERPGAEGAPLLPPPLPPPS[99.98]PPGS[0.02]GR_2 | 1096.802 | 4 | 46154 | 46157 | 34.0 | 6958950000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2024869 | C3N-02421 | C3N.02421.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | DOCK2 | NP_004937.1(pre=K,post=L) | dedicator of cytokinesis protein 2 GN=DOCK2 | ASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPR_AS[98.55]VLS[0.24]QMS[0.24]FAS[0.24]QS[0.24]MPT[0.24]IPALALS[0.24]VAGIPGLDEANT[0.00]S[0.00]PR_1 | 1035.7781 | 4 | 47628 | 47644 | 46.0 | 62189500.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2024870 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | DOCK2 | NP_004937.1(pre=K,post=L) | dedicator of cytokinesis protein 2 GN=DOCK2 | ASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPR_AS[98.55]VLS[0.24]QMS[0.24]FAS[0.24]QS[0.24]MPT[0.24]IPALALS[0.24]VAGIPGLDEANT[0.00]S[0.00]PR_1 | 1035.7781 | 4 | 47628 | 47644 | 46.0 | 62189500.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2024871 | C3N-02158 | C3N.02158.N | LUAD | 128N | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | DOCK2 | NP_004937.1(pre=K,post=L) | dedicator of cytokinesis protein 2 GN=DOCK2 | ASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPR_AS[98.55]VLS[0.24]QMS[0.24]FAS[0.24]QS[0.24]MPT[0.24]IPALALS[0.24]VAGIPGLDEANT[0.00]S[0.00]PR_1 | 1035.7781 | 4 | 47628 | 47644 | 46.0 | 62189500.0 | |||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2025873 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | SYNPO | NP_001159680.1(pre=R,post=A) | synaptopodin isoform C GN=SYNPO | SSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSR_S[0.00]S[0.00]PGLY[0.00]T[0.00]S[0.00]PGQDS[0.00]LQPT[0.00]AVS[0.00]PPY[0.00]GGDIS[0.00]PVS[2.21]PS[97.79]R_1 | 928.4499 | 4 | 31428 | 31429 | 41.0 | 4317460000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2026882 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | BLVRA | NP_000703.2(pre=R,post=S) | biliverdin reductase A precursor GN=BLVRA | YLSFHFK_Y[0.00]LS[100.00]FHFK_1 | 493.9332 | 3 | 32499 | 32504 | 54.0 | 1142180000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2026883 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | BLVRA | NP_000703.2(pre=R,post=S) | biliverdin reductase A precursor GN=BLVRA | YLSFHFK_Y[0.00]LS[100.00]FHFK_1 | 493.9332 | 3 | 32499 | 32504 | 54.0 | 1142180000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2028882 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TNRC6B | NP_001155973.1(pre=R,post=I) | trinucleotide repeat-containing gene 6B protein isoform 1 GN=TNRC6B | GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNK_GGS[99.75]PY[0.23]NQFDIIPGDT[0.01]LGGHT[0.00]GPAGDS[0.00]WLPAKS[100.00]PPT[0.00]NK_2 | 920.2546 | 5 | 35115 | 35117 | 28.0 | 746009000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2028883 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TNRC6B | NP_001155973.1(pre=R,post=I) | trinucleotide repeat-containing gene 6B protein isoform 1 GN=TNRC6B | GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNK_GGS[99.75]PY[0.23]NQFDIIPGDT[0.01]LGGHT[0.00]GPAGDS[0.00]WLPAKS[100.00]PPT[0.00]NK_2 | 920.2546 | 5 | 35115 | 35117 | 28.0 | 746009000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2028884 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | TNRC6B | NP_001155973.1(pre=R,post=I) | trinucleotide repeat-containing gene 6B protein isoform 1 GN=TNRC6B | GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNK_GGS[99.75]PY[0.23]NQFDIIPGDT[0.01]LGGHT[0.00]GPAGDS[0.00]WLPAKS[100.00]PPT[0.00]NK_2 | 920.2546 | 5 | 35115 | 35117 | 28.0 | 746009000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2028887 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TNRC6B | NP_001155973.1(pre=R,post=I) | trinucleotide repeat-containing gene 6B protein isoform 1 GN=TNRC6B | GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNK_GGS[99.75]PY[0.23]NQFDIIPGDT[0.01]LGGHT[0.00]GPAGDS[0.00]WLPAKS[100.00]PPT[0.00]NK_2 | 920.2546 | 5 | 35115 | 35117 | 28.0 | 746009000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2029896 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NES | NP_006608.1(pre=K,post=E) | nestin GN=NES | SAGQENLETLKSPETQAPLWTPEEINQGAMNPLEK_S[0.01]AGQENLET[0.18]LKS[0.18]PET[95.71]QAPLWT[3.93]PEEINQGAMNPLEK_1 | 1159.3496 | 4 | 36367 | 36368 | 67.0 | 1051080000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2029897 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NES | NP_006608.1(pre=K,post=E) | nestin GN=NES | SAGQENLETLKSPETQAPLWTPEEINQGAMNPLEK_S[0.01]AGQENLET[0.18]LKS[0.18]PET[95.71]QAPLWT[3.93]PEEINQGAMNPLEK_1 | 1159.3496 | 4 | 36367 | 36368 | 67.0 | 1051080000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2029898 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | NES | NP_006608.1(pre=K,post=E) | nestin GN=NES | SAGQENLETLKSPETQAPLWTPEEINQGAMNPLEK_S[0.01]AGQENLET[0.18]LKS[0.18]PET[95.71]QAPLWT[3.93]PEEINQGAMNPLEK_1 | 1159.3496 | 4 | 36367 | 36368 | 67.0 | 1051080000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2029899 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | NES | NP_006608.1(pre=K,post=E) | nestin GN=NES | SAGQENLETLKSPETQAPLWTPEEINQGAMNPLEK_S[0.01]AGQENLET[0.18]LKS[0.18]PET[95.71]QAPLWT[3.93]PEEINQGAMNPLEK_1 | 1159.3496 | 4 | 36367 | 36368 | 67.0 | 1051080000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2029900 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | NES | NP_006608.1(pre=K,post=E) | nestin GN=NES | SAGQENLETLKSPETQAPLWTPEEINQGAMNPLEK_S[0.01]AGQENLET[0.18]LKS[0.18]PET[95.71]QAPLWT[3.93]PEEINQGAMNPLEK_1 | 1159.3496 | 4 | 36367 | 36368 | 67.0 | 1051080000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2030911 | C3N-02421 | C3N.02421.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | KANK2 | NP_056308.3(pre=R,post=S) | KN motif and ankyrin repeat domain-containing protein 2 isoform 1 GN=KANK2 | LEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPR_LEDQAAT[0.01]PT[0.01]GLGS[0.01]LT[0.15]PS[3.61]AAGS[92.60]T[3.61]AS[0.01]LVGVGLPPPT[0.00]PR_1 | 924.7305 | 4 | 40729 | 40733 | 88.0 | 406330000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2030912 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | KANK2 | NP_056308.3(pre=R,post=S) | KN motif and ankyrin repeat domain-containing protein 2 isoform 1 GN=KANK2 | LEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPR_LEDQAAT[0.01]PT[0.01]GLGS[0.01]LT[0.15]PS[3.61]AAGS[92.60]T[3.61]AS[0.01]LVGVGLPPPT[0.00]PR_1 | 924.7305 | 4 | 40729 | 40733 | 88.0 | 406330000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2030913 | C3N-02158 | C3N.02158.N | LUAD | 128N | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | KANK2 | NP_056308.3(pre=R,post=S) | KN motif and ankyrin repeat domain-containing protein 2 isoform 1 GN=KANK2 | LEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPR_LEDQAAT[0.01]PT[0.01]GLGS[0.01]LT[0.15]PS[3.61]AAGS[92.60]T[3.61]AS[0.01]LVGVGLPPPT[0.00]PR_1 | 924.7305 | 4 | 40729 | 40733 | 88.0 | 406330000.0 | |||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2031914 | C3N-00704 | C3N.00704.N | LUAD | 127N | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | No | PITPNM2 | NP_065896.1(pre=R,post=I) | membrane-associated phosphatidylinositol transfer protein 2 isoform 1 GN=PITPNM2 | VASSVEQLNIIEDEVSQPLAAPPSK_VAS[50.00]S[50.00]VEQLNIIEDEVS[0.00]QPLAAPPS[0.00]K_1 | 1053.8909 | 3 | 41933 | 41936 | 68.0 | 758672000.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2031915 | C3N-00704 | C3N.00704 | LUAD | 126 | Tumor_and_Normal | 68 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | Staging Incomplete | No | PITPNM2 | NP_065896.1(pre=R,post=I) | membrane-associated phosphatidylinositol transfer protein 2 isoform 1 GN=PITPNM2 | VASSVEQLNIIEDEVSQPLAAPPSK_VAS[50.00]S[50.00]VEQLNIIEDEVS[0.00]QPLAAPPS[0.00]K_1 | 1053.8909 | 3 | 41933 | 41936 | 68.0 | 758672000.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2031916 | C3N-00294 | C3N.00294 | LUAD | 130C | Tumor | 57 | Male | Lower Lobe | 6 | Adenocarcinoma | GX Grade cannot be assessed | Unifocal | Right | Stage IIB | Poland | Not identified | Seventh Edition (2010) | pT2b | pN1 | No pathologic evidence of distant metastasis | cM0 | No | PITPNM2 | NP_065896.1(pre=R,post=I) | membrane-associated phosphatidylinositol transfer protein 2 isoform 1 GN=PITPNM2 | VASSVEQLNIIEDEVSQPLAAPPSK_VAS[50.00]S[50.00]VEQLNIIEDEVS[0.00]QPLAAPPS[0.00]K_1 | 1053.8909 | 3 | 41933 | 41936 | 68.0 | 758672000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2031917 | C3N-00556 | C3N.00556.N | LUAD | 130N | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | PITPNM2 | NP_065896.1(pre=R,post=I) | membrane-associated phosphatidylinositol transfer protein 2 isoform 1 GN=PITPNM2 | VASSVEQLNIIEDEVSQPLAAPPSK_VAS[50.00]S[50.00]VEQLNIIEDEVS[0.00]QPLAAPPS[0.00]K_1 | 1053.8909 | 3 | 41933 | 41936 | 68.0 | 758672000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f06.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2031918 | C3N-00556 | C3N.00556 | LUAD | 129C | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | PITPNM2 | NP_065896.1(pre=R,post=I) | membrane-associated phosphatidylinositol transfer protein 2 isoform 1 GN=PITPNM2 | VASSVEQLNIIEDEVSQPLAAPPSK_VAS[50.00]S[50.00]VEQLNIIEDEVS[0.00]QPLAAPPS[0.00]K_1 | 1053.8909 | 3 | 41933 | 41936 | 68.0 | 758672000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2032926 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | RANBP2 | NP_006258.3(pre=K,post=V) | E3 SUMO-protein ligase RanBP2 GN=RANBP2 | LPPTFFCGVCSDTDEDNGNGEDFQSELQK_LPPT[1.67]FFCGVCS[49.17]DT[49.17]DEDNGNGEDFQS[0.00]ELQK_1 | 961.9246 | 4 | 40255 | 40261 | 57.0 | 523438000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2032927 | C3N-01030 | C3N.01030.N | LUAD | 127N | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | RANBP2 | NP_006258.3(pre=K,post=V) | E3 SUMO-protein ligase RanBP2 GN=RANBP2 | LPPTFFCGVCSDTDEDNGNGEDFQSELQK_LPPT[1.67]FFCGVCS[49.17]DT[49.17]DEDNGNGEDFQS[0.00]ELQK_1 | 961.9246 | 4 | 40255 | 40261 | 57.0 | 523438000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2033936 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | AHNAK | NP_001333374.1(pre=K,post=I) | neuroblast differentiation-associated protein AHNAK isoform 1 GN=AHNAK | ISMPDIDLNLTGPK_IS[0.00]MPDIDLNLT[100.00]GPK_1 | 684.7026 | 3 | 41562 | 41563 | 81.0 | 2907900000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2033937 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | AHNAK | NP_001333374.1(pre=K,post=I) | neuroblast differentiation-associated protein AHNAK isoform 1 GN=AHNAK | ISMPDIDLNLTGPK_IS[0.00]MPDIDLNLT[100.00]GPK_1 | 684.7026 | 3 | 41562 | 41563 | 81.0 | 2907900000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2033938 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | AHNAK | NP_001333374.1(pre=K,post=I) | neuroblast differentiation-associated protein AHNAK isoform 1 GN=AHNAK | ISMPDIDLNLTGPK_IS[0.00]MPDIDLNLT[100.00]GPK_1 | 684.7026 | 3 | 41562 | 41563 | 81.0 | 2907900000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034934 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | AMER1 | NP_689637.3(pre=Q,post=E) | APC membrane recruitment protein 1 GN=AMER1 | KDEAAQAKGAAASGSTR_KDEAAQAKGAAAS[93.65]GS[3.17]T[3.17]R_1 | 796.1024 | 3 | 43618 | 43629 | 58.0 | 0.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034935 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034936 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034937 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034938 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034939 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2034940 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | FN3KRP | NP_078895.2(pre=R,post=S) | ketosamine-3-kinase GN=FN3KRP | ATGHSGGGCISQGR__0 | 525.2636 | 3 | 6643 | 6645 | 92.0 | 27349200.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2035938 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | MED13 | NP_005112.2(pre=R,post=A) | mediator of RNA polymerase II transcription subunit 13 GN=MED13 | LLSTEPHEEVPNILQQPLALGYFVSTAK_LLS[50.00]T[50.00]EPHEEVPNILQQPLALGY[0.00]FVS[0.00]T[0.00]AK_1 | 908.9893 | 4 | 46229 | 46232 | 84.0 | 242447000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2035939 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | MED13 | NP_005112.2(pre=R,post=A) | mediator of RNA polymerase II transcription subunit 13 GN=MED13 | LLSTEPHEEVPNILQQPLALGYFVSTAK_LLS[50.00]T[50.00]EPHEEVPNILQQPLALGY[0.00]FVS[0.00]T[0.00]AK_1 | 908.9893 | 4 | 46229 | 46232 | 84.0 | 242447000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2035940 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | MED13 | NP_005112.2(pre=R,post=A) | mediator of RNA polymerase II transcription subunit 13 GN=MED13 | LLSTEPHEEVPNILQQPLALGYFVSTAK_LLS[50.00]T[50.00]EPHEEVPNILQQPLALGY[0.00]FVS[0.00]T[0.00]AK_1 | 908.9893 | 4 | 46229 | 46232 | 84.0 | 242447000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2035941 | C3N-01030 | C3N.01030.N | LUAD | 127N | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | MED13 | NP_005112.2(pre=R,post=A) | mediator of RNA polymerase II transcription subunit 13 GN=MED13 | LLSTEPHEEVPNILQQPLALGYFVSTAK_LLS[50.00]T[50.00]EPHEEVPNILQQPLALGY[0.00]FVS[0.00]T[0.00]AK_1 | 908.9893 | 4 | 46229 | 46232 | 84.0 | 242447000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2035942 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | MED13 | NP_005112.2(pre=R,post=A) | mediator of RNA polymerase II transcription subunit 13 GN=MED13 | LLSTEPHEEVPNILQQPLALGYFVSTAK_LLS[50.00]T[50.00]EPHEEVPNILQQPLALGY[0.00]FVS[0.00]T[0.00]AK_1 | 908.9893 | 4 | 46229 | 46232 | 84.0 | 242447000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036958 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | H1FX | NP_006017.1(pre=K,post=R) | histone H1x GN=H1FX | AAPGAAGSR__0 | 493.7829 | 2 | 6806 | 6808 | 73.0 | 25577100.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036959 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NP_001091952.1(pre=R,post=P) | LGSPHRR_LGS[100]PHRR_1 | 377.8715 | 3 | 6910 | 6916 | 55.0 | 9556560.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036960 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NP_001091952.1(pre=R,post=P) | LGSPHRR_LGS[100]PHRR_1 | 377.8715 | 3 | 6910 | 6916 | 55.0 | 9556560.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036961 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | NP_001091952.1(pre=R,post=P) | LGSPHRR_LGS[100]PHRR_1 | 377.8715 | 3 | 6910 | 6916 | 55.0 | 9556560.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036962 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | NP_001091952.1(pre=R,post=P) | LGSPHRR_LGS[100]PHRR_1 | 377.8715 | 3 | 6910 | 6916 | 55.0 | 9556560.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2036963 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | NP_001091952.1(pre=R,post=P) | LGSPHRR_LGS[100]PHRR_1 | 377.8715 | 3 | 6910 | 6916 | 55.0 | 9556560.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2037988 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TNS2 | NP_056134.2(pre=K,post=S) | tensin-2 isoform 1 GN=TNS2 | APELPSGSGPEPLAPSPVSPTFPPSSPSDWPQER_APELPS[47.94]GS[2.00]GPEPLAPS[0.00]PVS[0.00]PT[0.00]FPPS[2.00]S[47.94]PS[0.09]DWPQER_1 | 952.4661 | 4 | 37423 | 37431 | 63.0 | 61876000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2037989 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TNS2 | NP_056134.2(pre=K,post=S) | tensin-2 isoform 1 GN=TNS2 | APELPSGSGPEPLAPSPVSPTFPPSSPSDWPQER_APELPS[47.94]GS[2.00]GPEPLAPS[0.00]PVS[0.00]PT[0.00]FPPS[2.00]S[47.94]PS[0.09]DWPQER_1 | 952.4661 | 4 | 37423 | 37431 | 63.0 | 61876000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2037990 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | TNS2 | NP_056134.2(pre=K,post=S) | tensin-2 isoform 1 GN=TNS2 | APELPSGSGPEPLAPSPVSPTFPPSSPSDWPQER_APELPS[47.94]GS[2.00]GPEPLAPS[0.00]PVS[0.00]PT[0.00]FPPS[2.00]S[47.94]PS[0.09]DWPQER_1 | 952.4661 | 4 | 37423 | 37431 | 63.0 | 61876000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f11.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2037991 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | TNS2 | NP_056134.2(pre=K,post=S) | tensin-2 isoform 1 GN=TNS2 | APELPSGSGPEPLAPSPVSPTFPPSSPSDWPQER_APELPS[47.94]GS[2.00]GPEPLAPS[0.00]PVS[0.00]PT[0.00]FPPS[2.00]S[47.94]PS[0.09]DWPQER_1 | 952.4661 | 4 | 37423 | 37431 | 63.0 | 61876000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2041045 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | NP_059345.1(pre=R,post=S) | LHMSLQQGK_LHMS[100]LQQGK_1 | 532.6181 | 3 | 15725 | 15734 | 47.0 | 457940000.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2041046 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | NP_059345.1(pre=R,post=S) | LHMSLQQGK_LHMS[100]LQQGK_1 | 532.6181 | 3 | 15725 | 15734 | 47.0 | 457940000.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2041047 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | NP_059345.1(pre=R,post=S) | LHMSLQQGK_LHMS[100]LQQGK_1 | 532.6181 | 3 | 15725 | 15734 | 47.0 | 457940000.0 | ||||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042061 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042062 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042063 | C3N-00552 | C3N.00552.N | LUAD | 129N | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042064 | C3N-00552 | C3N.00552 | LUAD | 128C | Tumor_and_Normal | 49 | Female | Other | 5 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042065 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2042066 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | CTR9 | NP_055448.1(pre=R,post=K) | RNA polymerase-associated protein CTR9 homolog isoform 1 GN=CTR9 | KGSGSEQEGEDEEGGER_KGS[100]GS[100]EQEGEDEEGGER_2 | 800.0019 | 3 | 10358 | 10363 | 61.0 | 209553000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043097 | C3N-02588 | C3N.02588.N | LUAD | 128N | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | THRAP3 | NP_001308400.1(pre=K,post=A) | thyroid hormone receptor-associated protein 3 isoform 1 GN=THRAP3 | HGLAHDEMKSPREPGYK_HGLAHDEMKS[100.00]PREPGY[0.00]K_1 | 547.8858 | 5 | 12329 | 12331 | 85.0 | 2635650000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043098 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | THRAP3 | NP_001308400.1(pre=K,post=A) | thyroid hormone receptor-associated protein 3 isoform 1 GN=THRAP3 | HGLAHDEMKSPREPGYK_HGLAHDEMKS[100.00]PREPGY[0.00]K_1 | 547.8858 | 5 | 12329 | 12331 | 85.0 | 2635650000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043099 | C3N-01030 | C3N.01030.N | LUAD | 127N | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | THRAP3 | NP_001308400.1(pre=K,post=A) | thyroid hormone receptor-associated protein 3 isoform 1 GN=THRAP3 | HGLAHDEMKSPREPGYK_HGLAHDEMKS[100.00]PREPGY[0.00]K_1 | 547.8858 | 5 | 12329 | 12331 | 85.0 | 2635650000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043100 | C3N-01030 | C3N.01030 | LUAD | 126 | Tumor_and_Normal | 56 | Male | Upper Lobe | 5 | Other | G3 Poorly differentiated | Unifocal | Right | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | THRAP3 | NP_001308400.1(pre=K,post=A) | thyroid hormone receptor-associated protein 3 isoform 1 GN=THRAP3 | HGLAHDEMKSPREPGYK_HGLAHDEMKS[100.00]PREPGY[0.00]K_1 | 547.8858 | 5 | 12329 | 12331 | 85.0 | 2635650000.0 | ||||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043101 | C3L-01889 | C3L.01889.N | LUAD | 130N | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | JCAD | NP_001336951.1(pre=R,post=Q) | junctional protein associated with coronary artery disease isoform 1 GN=JCAD | GQWPDVRGSQHGHTGR_GQWPDVRGS[100.00]QHGHT[0.00]GR_1 | 521.7505 | 4 | 12329 | 12333 | 97.0 | 483248000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Phosphoproteome_BI_20180423 | 04CPTAC_LUAD_P_BI_20180423_BD_f12.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2043102 | C3L-01889 | C3L.01889 | LUAD | 129C | Tumor_and_Normal | 71 | Female | White | Not-Hispanic or Latino | Upper Lobe | 2 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | No | JCAD | NP_001336951.1(pre=R,post=Q) | junctional protein associated with coronary artery disease isoform 1 GN=JCAD | GQWPDVRGSQHGHTGR_GQWPDVRGS[100.00]QHGHT[0.00]GR_1 | 521.7505 | 4 | 12329 | 12333 | 97.0 | 483248000.0 | ||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f07.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2044113 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | RANBP2 | NP_006258.3(pre=K,post=W) | E3 SUMO-protein ligase RanBP2 GN=RANBP2 | LNSSNSASPHR_LNS[0.00]S[0.00]NS[0.00]AS[100.00]PHR_1 | 493.5706 | 3 | 7070 | 7072 | 60.0 | 427891000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f07.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2045118 | C3N-02158 | C3N.02158.N | LUAD | 128N | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | SMARCA4 | NP_001122321.1(pre=R,post=S) | transcription activator BRG1 isoform A GN=SMARCA4 | KRDSDAGSSTPTTSTR_KRDS[100.00]DAGS[0.00]S[0.00]T[0.00]PT[0.00]T[0.00]S[0.00]T[0.00]R_1 | 735.7044 | 3 | 6561 | 6566 | 85.0 | 173277000.0 | |||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f07.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2045133 | C3N-00556 | C3N.00556 | LUAD | 129C | Tumor_and_Normal | 69 | Male | Other | 6 | Other | G3 Poorly differentiated | Unifocal | Left | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | Staging Incomplete | cM0 | No | PRKAB1 | NP_006244.2(pre=R,post=I) | 5'-AMP-activated protein kinase subunit beta-1 GN=PRKAB1 | RDSSGGTKDGDRPK_RDS[95.06]S[2.47]GGT[2.47]KDGDRPK_1 | 561.5489 | 4 | 6605 | 6609 | 67.0 | 2737880000.0 | ||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f07.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2046136 | C3N-02158 | C3N.02158 | LUAD | 127C | Tumor_and_Normal | 54 | Female | Other | 6 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Stage IIIA | Vietnam | Not identified | Seventh Edition (2010) | pT3 | pN2 | Staging Incomplete | cM0 | No | KISS1R | NP_115940.2(pre=R,post=A) | kiSS-1 receptor GN=KISS1R | LGSHPAPAR_LGS[100]HPAPAR_1 | 405.5464 | 3 | 9653 | 9662 | 75.0 | 22769300.0 | |||||||||||||||||||||||||||||||
16CPTAC_LUAD_Phosphoproteome_BI_20180614 | 16CPTAC_LUAD_P_BI_20180614_BD_f07.raw | CPTAC_Phosphoproteome | 20180425 | 20221101 | 2047139 | C3N-02421 | C3N.02421 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Lower Lobe | 3 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IA | China | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | cM0 | No | BAG3 | NP_004272.2(pre=R,post=S) | BAG family molecular chaperone regulator 3 GN=BAG3 | SQSPAASDCSSSSSSASLPSSGR_S[49.55]QS[49.55]PAAS[0.90]DCS[0.00]S[0.00]S[0.00]S[0.00]S[0.00]S[0.00]AS[0.00]LPS[0.00]S[0.00]GR_1 | 837.0266 | 3 | 11311 | 11318 | 144.0 | 145043000.0 |
판매제공처 홈페이지 | 판매담당자 | 연락처 | 이메일 |
---|---|---|---|
www.cellkey.co.kr | 셀키 | 0507-1387-0260 | sylee@cellkey.co.kr |
제약 및 취소/환불 규정 안내 |
---|
데이터 상품은 디지털화된 상품의 특성상 반품, 취소, 환불 되지 않으나 데이터의 심각한 오류, 상이한 데이터에 한하여 구매자가 요구하는 경우 환불을 진행할 수 있습니다. |