[감염병연구] |
폐질환·폐암(선암) 환자 의료 및 단백체 데이터 폐질환·폐암(선암) 환자 의료 및 단백체 데이터
|
데이터 기본 이용료
|
데이터등록일 | 데이터 수정일 | 데이터 이용기한 | 판매제공처 |
---|---|---|---|
2022-12-16 | 2023-07-05 | 무기한 | 셀키 |
데이터 제공포맷 | 데이터 제공방식 | 데이터 파일용량 | 데이터 상품구분 |
csv/zip | 다운로드 | 27.94 GB | dataset |
● 데이터 상품명 폐질환·폐암(선암) 환자 의료 및 단백체 데이터 ● 데이터 상품 부제 암 특화 임상 및 단백체 데이터와 의료데이터 ● 데이터 상품 요약 미국 국립암연구소 (NCI), 가톨릭대학교 의과대학의 폐질환·폐암(선암) 의료 및 단백체 정성·정량 분석 결과 ● 데이터 상품 정보 ■ 상품 설명 및 특징 - 국내 최초·최대 암 관련 (관련 질병 포함) 당 단백질 질량분석 실험 데이터의 해석 및 당·단백질 리포지토리를 구축하고 정밀의료 연구기술에 발전시키고자 함 - 참여 병원으로부터 제공된 폐질환 폐암(선암) 환자 시료를 전처리하여 고분해능 질량분석기기를 통해 최적화된 분석을 진행하고 당사에서 자체 개발한 분석솔루션 SpAC9 Pipeline을 활용하여 데이터분석 등의 프로세스를 통하여 표준화 기준에 맞춰 최종 데이터를 가공, 생산함 - NCI 의 CPTAC에서 제공된 질량분석이 완료된 선암 RAW 데이터는 SpAC9 Pipeline을 활용하여 재분석하고 표준화 기준에 맞춰 데이터를 가공·생산함 ■ 기간 및 범위 - 2022년 9월 ~ 2022년 10월 ■ 컬럼(속성) 정보 - 집계시작년월 : 2022년 9월 - 집계시작년월 : 2022년 10월 ■ 약어/전문용어 설명 - NCI: National Cancer Institute - CPTAC: Clinical Proteome Tumor Analysis Consortium ■ 활용 예제 - 시스템 확대·발전 - 의료 및 단백체 빅데이터 고도화를 위한 유전단백체 변이 아틀라스 구축으로 시스템 확대 및 발전 - 인간의 유전단백체 변이 아틀라스를 구축하여 질병 별로 유전자 변이가 단백질의 변이를 일으키는 경우의 데이터베이스 구축하여 질병의 이해와 개인 맞춤형 신약 개발 및 진단 발굴 사업에 필요한 데이터를 제공
그룹명
|
결과파일명
|
결과ID
|
질량분석기기분석일자
|
생성일자
|
수정일자
|
ID
|
환자ID
|
샘플ID
|
암코드
|
분석정보
|
샘플타입
|
환자나이
|
환자성별
|
환자인종
|
환자민족인종
|
환자종양위치
|
환자종양크기
|
병리학적종양타입명
|
병리학적종양등급
|
종양병소
|
종양측향화
|
병리학적병기분류
|
환자국적
|
종양괴사
|
병리학적진단
|
종양분화도
|
간경변병력
|
간결절크기
|
간염병력
|
B형간염표면항원
|
B형간염코어항체
|
프로트롬빈함량
|
빌리루빈함량
|
알부민함량
|
알라닌아미노전이효소함량
|
감마글루타밀전이효소함량
|
알파태아단백질함량
|
아스파르테이트아미노전달효소함량
|
알칼리인산분해효소함량
|
TNM병기분류
|
BCLC병기분류
|
AJCC병기분류
|
원발성종양병리학적상태
|
림프절전이병리학적상태
|
타장기전이병리학적상태
|
종양전이범위
|
암진단이력
|
치료이력
|
잔여종양병리학적상태
|
음주량
|
흡연이력
|
흡연나이
|
금연나이
|
하루흡연량
|
연간흡연량
|
12개월간종양크기
|
24개월간종양크기
|
유전자심볼
|
단백질심볼
|
단백질명
|
펩타이드명
|
펩타이드질량
|
펩타이드전하
|
펩타이드스캔1ID
|
펩타이드스캔2ID
|
펩타이드값
|
펩타이드함량
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29638067 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | CAST | NP_001741.4(pre=L,post=K) | calpastatin isoform a GN=CAST | KGTVPDDAVEALADSLGK | 825.1399 | 3 | 37567 | 37580 | 131.0 | 2470430000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29638284 | C3N-01024 | C3N.01024.N | LUAD | 130N | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | WDR1 | NP_059830.1(pre=R,post=F) | WD repeat-containing protein 1 isoform 1 GN=WDR1 | LATGSDDNCAAFFEGPPFK | 626.3178 | 4 | 37720 | 37722 | 122.0 | 6226270000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29638474 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | KRT8 | NP_001243211.1(pre=K,post=T) | keratin, type II cytoskeletal 8 isoform 1 GN=KRT8 | TTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSR | 1318.9688 | 3 | 37830 | 37832 | 232.0 | 1044020000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29638674 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | GC | NP_001191236.1(pre=K,post=E) | vitamin D-binding protein isoform 3 precursor GN=GC | SYLSMVGSCCTSASPTVCFLK | 938.4636 | 3 | 37937 | 37947 | 193.0 | 558925000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29638889 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | TRIM21 | NP_003132.2(pre=A,post=C) | E3 ubiquitin-protein ligase TRIM21 GN=TRIM21 | QQSQALQELISELDRR | 715.06 | 3 | 38034 | 38044 | 103.0 | 911343000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29639276 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | LAMTOR2 | NP_054736.1(pre=R,post=N) | ragulator complex protein LAMTOR2 isoform 1 GN=LAMTOR2 | VTAAIASNIWAAYDR | 926.0038 | 2 | 38251 | 38254 | 155.0 | 1333570000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29639344 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | KCNIP1 | NP_001265268.1(pre=K,post=Y) | Kv channel-interacting protein 1 isoform 5 GN=KCNIP1 | EEMMDIVKAIYDMMGK | 652.6004 | 4 | 38283 | 38291 | 39.0 | 230748000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29639807 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | METTL13 | NP_057019.3(pre=K,post=D) | methyltransferase-like protein 13 isoform 1 GN=METTL13 | VLVIGCGNSELSEQLYDVGYR | 867.4455 | 3 | 38518 | 38527 | 176.0 | 1401990000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29640150 | C3N-01024 | C3N.01024 | LUAD | 129C | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | TUBA1C | NP_001290043.1(pre=R,post=T) | tubulin alpha-1C chain isoform a GN=TUBA1C | AVFVDLEPTVIDEVR | 644.3649 | 3 | 38835 | 38838 | 99.0 | 631269000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29640503 | C3N-00579 | C3N.00579 | LUAD | 128C | Tumor_and_Normal | 67 | Male | Other | 4 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | F13A1 | NP_000120.2(pre=F,post=K) | coagulation factor XIII A chain precursor GN=F13A1 | AEVNSDLIYITAK | 948.0545 | 2 | 30389 | 30393 | 68.0 | 70605700.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29640541 | C3N-00199 | C3N.00199 | LUAD | 127C | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | DDX5 | NP_001307524.1(pre=K,post=Q) | probable ATP-dependent RNA helicase DDX5 isoform a GN=DDX5 | TGTAYTFFTPNNIK | 678.3765 | 3 | 30389 | 30405 | 85.0 | 2739150000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29640666 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | PAXX | NP_001316607.1(pre=R,post=G) | protein PAXX isoform 1 GN=PAXX | PAGPQLFLPDPDPQR | 939.0065 | 2 | 30486 | 30494 | 78.0 | 129906000.0 | ||||||||||||||||||||||||||||
04CPTAC_LUAD_Proteome_BI_20180524 | 04CPTAC_LUAD_W_BI_20180524_KR_f17.raw | CPTAC_Proteome | 20180524 | 20221101 | 1147981 | C3N-02588 | C3N.02588 | LUAD | 127C | Tumor_and_Normal | 69 | Male | Lower Lobe | 5 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2a | pN0 | pM1b | cM0 | No | CCZ1 | NP_056437.4(pre=R,post=N) | vacuolar fusion protein CCZ1 homolog GN=CCZ1 | ELYVILNQK | 789.4839 | 2 | 31274 | 31283 | 158.0 | 244730000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29641730 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | PCYOX1 | NP_057381.3(pre=K,post=Q) | prenylcysteine oxidase 1 precursor GN=PCYOX1 | IAIIGAGIGGTSAAYYLR | 666.0549 | 3 | 39384 | 39385 | 118.0 | 1301530000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29641892 | C3N-02582 | C3N.02582 | LUAD | 129C | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | PNP | NP_000261.2(pre=R,post=V) | purine nucleoside phosphorylase GN=PNP | FHMYEGYPLWK | 483.0109 | 4 | 31080 | 31082 | 16.0 | 113247000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29642015 | C3N-02379 | C3N.02379.1 | LUAD | 130C | Tumor_and_Normal | 57 | Female | Upper Lobe | 4 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | China | Not identified | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | No | LTN1 | NP_056380.2(pre=K,post=E) | E3 ubiquitin-protein ligase listerin isoform 1 GN=LTN1 | DEITSVLQDHLIK | 657.0491 | 3 | 31119 | 31123 | 175.0 | 163042000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29642192 | C3N-00199 | C3N.00199 | LUAD | 127C | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | ATP6V1C1 | NP_001686.1(pre=K,post=S) | V-type proton ATPase subunit C 1 GN=ATP6V1C1 | QYETLAEMVVPR | 555.6351 | 3 | 31256 | 31260 | 114.0 | 132391000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29642709 | C3N-02582 | C3N.02582.N | LUAD | 130N | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | CKB | NP_001349460.1(pre=K,post=A) | creatine kinase B-type isoform 2 GN=CKB | VLTPELYAELR | 511.6363 | 3 | 31774 | 31779 | 53.0 | 707951000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29644344 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | LAMA2 | NP_000417.2(pre=K,post=L) | laminin subunit alpha-2 isoform a precursor GN=LAMA2 | CDCPLGYSGLSCEACLPGFYR | 904.4081 | 3 | 32504 | 32510 | 68.0 | 37502200.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29644587 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | PRELP | NP_002716.1(pre=P,post=N) | prolargin precursor GN=PRELP | GLVFLYMEK | 525.3069 | 3 | 32626 | 32632 | 33.0 | 235112000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29644848 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | PPM1F | NP_055449.1(pre=R,post=Q) | protein phosphatase 1F GN=PPM1F | LWEVAGQWQK | 568.3281 | 3 | 32766 | 32770 | 54.0 | 692834000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29645112 | C3N-02582 | C3N.02582 | LUAD | 129C | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | TACC2 | NP_996744.3(pre=R,post=S) | transforming acidic coiled-coil-containing protein 2 isoform a GN=TACC2 | MESFLTLESEK | 886.4875 | 2 | 32903 | 32904 | 103.0 | 37318700.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29645717 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | MARF1 | NP_001171927.1(pre=K,post=S) | meiosis regulator and mRNA stability factor 1 isoform 2 GN=MARF1 | ILVSLATGAASK | 530.3411 | 3 | 33150 | 33156 | 41.0 | 12789600.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29646905 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | TCP1 | NP_110379.2(pre=R,post=T) | T-complex protein 1 subunit alpha isoform a GN=TCP1 | YINENLIVNTDELGRDCLINAAK | 777.4231 | 4 | 33742 | 33745 | 153.0 | 442271000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29646906 | C3N-02379 | C3N.02379.1 | LUAD | 130C | Tumor_and_Normal | 57 | Female | Upper Lobe | 4 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | China | Not identified | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | No | TCP1 | NP_110379.2(pre=R,post=T) | T-complex protein 1 subunit alpha isoform a GN=TCP1 | YINENLIVNTDELGRDCLINAAK | 777.4231 | 4 | 33742 | 33745 | 153.0 | 442271000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29646925 | C3N-02582 | C3N.02582.N | LUAD | 130N | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | PRPF4 | NP_004688.2(pre=K,post=G) | U4/U6 small nuclear ribonucleoprotein Prp4 isoform 1 GN=PRPF4 | LWSVPDCNLLHTLR | 651.6915 | 3 | 33748 | 33755 | 67.0 | 174270000.0 | ||||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243706 | 11LU022 | X11LU022 | LUAD | 130C | Tumor | 53 | Male | Other | 4 | Other | GX Grade cannot be assessed | Unifocal | Left | Stage IB | Vietnam | Present | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | DPYSL3 | NP_001184223.1(pre=R,post=I) | dihydropyrimidinase-related protein 3 isoform 1 GN=DPYSL3 | ISVGSDSDLVIWDPDAVK | 1187.6492 | 2 | 38761 | 38766 | 92.0 | 51784600.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29647076 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | LARP1 | NP_056130.2(pre=K,post=E) | la-related protein 1 GN=LARP1 | WVPLQIDMKPEVPR | 542.3197 | 4 | 33831 | 33832 | 60.0 | 29316800.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29647215 | C3N-00579 | C3N.00579.N | LUAD | 129N | Tumor_and_Normal | 67 | Male | Other | 4 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | TARS | NP_001245367.1(pre=R,post=W) | threonine--tRNA ligase, cytoplasmic isoform 2 GN=TARS | MIAILTENYGGK | 590.0085 | 3 | 33900 | 33903 | 91.0 | 1444780000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29647308 | C3N-00199 | C3N.00199 | LUAD | 127C | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | BCCIP | NP_057651.1(pre=K,post=F) | BRCA2 and CDKN1A-interacting protein isoform BCCIPalpha GN=BCCIP | FLNDTTKPVGLLLSER | 754.4473 | 3 | 33952 | 33962 | 213.0 | 624834000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29647322 | C3N-02582 | C3N.02582 | LUAD | 129C | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | UBA1 | NP_003325.2(pre=R,post=R) | ubiquitin-like modifier-activating enzyme 1 GN=UBA1 | QLLHNFPPDQLTSSGAPFWSGPK | 994.8661 | 3 | 33952 | 33964 | 153.0 | 2117860000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29647555 | C3N-02582 | C3N.02582 | LUAD | 129C | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | PSMC5 | NP_002796.4(pre=R,post=I) | 26S proteasome regulatory subunit 8 isoform 1 GN=PSMC5 | IDILDSALLRPGR | 556.6737 | 3 | 34051 | 34056 | 110.0 | 5254460000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29648176 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | PRKDC | NP_008835.5(pre=K,post=A) | DNA-dependent protein kinase catalytic subunit isoform 1 GN=PRKDC | ETGLMYSIMVHALR | 617.3376 | 3 | 39038 | 39047 | 90.0 | 19239000000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29649463 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | MAPK8IP3 | NP_001305781.1(pre=K,post=N) | C-Jun-amino-terminal kinase-interacting protein 3 isoform 3 GN=MAPK8IP3 | EVGNLLLENSQLLETK | 753.4314 | 3 | 39790 | 39796 | 101.0 | 93707700.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29649474 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | SYAP1 | NP_116185.2(pre=K,post=N) | synapse-associated protein 1 GN=SYAP1 | KSEAAVPPWVDTNDEETIQQQILALSADKR | 808.8445 | 5 | 39800 | 39801 | 160.0 | 603754000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29649615 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | ALDOA | NP_001230106.1(pre=K,post=A) | fructose-bisphosphate aldolase A isoform 2 GN=ALDOA | CPLLKPWALTFSYGR | 756.4354 | 3 | 39904 | 39910 | 129.0 | 6955480000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29649967 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | DNPEP | NP_001306045.1(pre=Y,post=V) | aspartyl aminopeptidase isoform a GN=DNPEP | GGGIWSTWFDRDLTLAGR | 746.3928 | 3 | 40146 | 40148 | 67.0 | 24665300.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29649997 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | TRAF2 | NP_066961.2(pre=K,post=-) | TNF receptor-associated factor 2 GN=TRAF2 | AIVDLTGL | 515.8222 | 2 | 40169 | 40170 | 90.0 | 236968000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29650237 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | SERPINB6 | NP_001258752.1(pre=R,post=S) | serpin B6 isoform d GN=SERPINB6 | FCADHPFLFFIQH | 636.6541 | 3 | 40287 | 40290 | 137.0 | 3338090000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29650588 | C3N-01024 | C3N.01024 | LUAD | 129C | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | MRPS22 | NP_064576.1(pre=P,post=M) | 28S ribosomal protein S22, mitochondrial isoform 1 GN=MRPS22 | TFMDEEVQSILTK | 667.0336 | 3 | 40511 | 40514 | 108.0 | 1055390000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29651715 | C3N-01024 | C3N.01024.N | LUAD | 130N | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | FAM122A | NP_612206.4(pre=K,post=-) | protein FAM122A GN=FAM122A | VSTTTDSPVSPAQAASPFIPLDELSSK | 1068.5789 | 3 | 41164 | 41175 | 171.0 | 362819000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29651733 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | ASAH1 | NP_004306.3(pre=K,post=G) | acid ceramidase isoform b GN=ASAH1 | LTVYTTLIDVTK | 609.0416 | 3 | 41187 | 41189 | 116.0 | 39956900000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29651864 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | MYLK | NP_444253.3(pre=K,post=D) | myosin light chain kinase, smooth muscle isoform 1 GN=MYLK | IEGYPDPEVVWFK | 679.7085 | 3 | 41263 | 41272 | 125.0 | 8413130000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29652405 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | NP_919337.1(pre=K,post=E) | FVEAMAEYNEAQTLFR | 716.6949 | 3 | 41537 | 41547 | 144.0 | 157822000.0 | ||||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29652639 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | TUBB6 | NP_001290453.1(pre=K,post=R) | tubulin beta-6 chain isoform 1 GN=TUBB6 | MASTFIGNSTAIQELFK | 778.0926 | 3 | 41677 | 41678 | 89.0 | 10823500000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29652985 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | MIA2 | NP_001316143.1(pre=R,post=L) | cTAGE family member 5 isoform 8 precursor GN=MIA2 | AFLSPPTLLEGPLR | 580.6817 | 3 | 41918 | 41924 | 67.0 | 605415000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653062 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | SERPINA1 | NP_000286.3(pre=K,post=E) | alpha-1-antitrypsin precursor GN=SERPINA1 | AVLTIDEKGTEAAGAMFL | 765.7625 | 3 | 41966 | 41970 | 194.0 | 353030000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653400 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | TOP1 | NP_003277.1(pre=K,post=E) | DNA topoisomerase 1 GN=TOP1 | HKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHK | 1198.69 | 6 | 42192 | 42209 | -101.0 | 63097000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653574 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | KDM1A | NP_001009999.1(pre=R,post=Q) | lysine-specific histone demethylase 1A isoform a GN=KDM1A | IADQFLGAMYTLPR | 609.0029 | 3 | 42311 | 42315 | 112.0 | 931314000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653774 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | TBCC | NP_003183.1(pre=R,post=D) | tubulin-specific chaperone C GN=TBCC | AIVEDCSGIQFAPYTWSYPEIDK | 787.6522 | 4 | 42374 | 42386 | 156.0 | 169960000.0 | ||||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243735 | C3L-00913 | C3L.00913 | LUAD | 129C | Tumor_and_Normal | 66 | Male | White | Not-Hispanic or Latino | Other | 8 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IIIA | United States | Present | Seventh Edition (2010) | pT3 | pN1 | No pathologic evidence of distant metastasis | cM1 | No | APOA1 | NP_000030.1(pre=R,post=E) | apolipoprotein A-I isoform 1 preproprotein GN=APOA1 | EQLGPVTQEFWDNLEK | 1196.1316 | 2 | 38796 | 38797 | 261.0 | 1320820.0 | ||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243736 | C3L-00510 | C3L.00510.N | LUAD | 129N | Tumor_and_Normal | 80 | Female | Unknown | Not reported | Lower Lobe | 3 | Adenocarcinoma | G1 Well differentiated | Unifocal | Right | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | APOA1 | NP_000030.1(pre=R,post=E) | apolipoprotein A-I isoform 1 preproprotein GN=APOA1 | EQLGPVTQEFWDNLEK | 1196.1316 | 2 | 38796 | 38797 | 261.0 | 1320820.0 | ||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243737 | C3L-00510 | C3L.00510 | LUAD | 128C | Tumor_and_Normal | 80 | Female | Unknown | Not reported | Lower Lobe | 3 | Adenocarcinoma | G1 Well differentiated | Unifocal | Right | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | APOA1 | NP_000030.1(pre=R,post=E) | apolipoprotein A-I isoform 1 preproprotein GN=APOA1 | EQLGPVTQEFWDNLEK | 1196.1316 | 2 | 38796 | 38797 | 261.0 | 1320820.0 | ||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243738 | C3L-00093 | C3L.00093.N | LUAD | 128N | Tumor_and_Normal | 66 | Female | White | Not-Hispanic or Latino | Lower Lobe | 3 | Other | G2 Moderately differentiated | Unifocal | Left | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | Yes | APOA1 | NP_000030.1(pre=R,post=E) | apolipoprotein A-I isoform 1 preproprotein GN=APOA1 | EQLGPVTQEFWDNLEK | 1196.1316 | 2 | 38796 | 38797 | 261.0 | 1320820.0 | ||||||||||||||||||||||||||||
10CPTAC_LUAD_Proteome_BI_20180626 | 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw | CPTAC_Proteome | 20180524 | 20221101 | 20243739 | C3L-00093 | C3L.00093 | LUAD | 127C | Tumor_and_Normal | 66 | Female | White | Not-Hispanic or Latino | Lower Lobe | 3 | Other | G2 Moderately differentiated | Unifocal | Left | Stage IB | United States | Not identified | Seventh Edition (2010) | pT2a | pN0 | No pathologic evidence of distant metastasis | cM0 | Yes | APOA1 | NP_000030.1(pre=R,post=E) | apolipoprotein A-I isoform 1 preproprotein GN=APOA1 | EQLGPVTQEFWDNLEK | 1196.1316 | 2 | 38796 | 38797 | 261.0 | 1320820.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653798 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | FLNA | NP_001104026.1(pre=R,post=P) | filamin-A isoform 2 GN=FLNA | ALGALVDSCAPGLCPDWDSWDASK | 610.7016 | 5 | 42395 | 42399 | 89.0 | 735778000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29653862 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | POLR2B | NP_000929.1(pre=R,post=F) | DNA-directed RNA polymerase II subunit RPB2 isoform 1 GN=POLR2B | TSETGIVDQVMVTLNQEGYK | 890.8079 | 3 | 42395 | 42412 | 173.0 | 1232330000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29654554 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | MARS | NP_004981.2(pre=R,post=F) | methionine--tRNA ligase, cytoplasmic GN=MARS | GVGVFGDMAQDTGIPADIWR | 1167.5912 | 2 | 42828 | 42845 | 236.0 | 117193000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29654629 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | SDCBP | NP_001335270.1(pre=R,post=A) | syntenin-1 isoform 7 GN=SDCBP | LYPELSQYMGLSLNEEEIR | 838.4338 | 3 | 42914 | 42915 | 145.0 | 3958520000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29655194 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | SQOR | NP_001258142.1(pre=K,post=T) | sulfide:quinone oxidoreductase, mitochondrial GN=SQOR | QEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLK | 1157.3698 | 4 | 43207 | 43225 | 255.0 | 1067250000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29655405 | C3N-01024 | C3N.01024.N | LUAD | 130N | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NNT | NP_036475.3(pre=K,post=L) | NAD(P) transhydrogenase, mitochondrial isoform 1 GN=NNT | TSGTLISFIYPAQNPELLNK | 1332.7559 | 2 | 43327 | 43329 | 153.0 | 0.0 | ||||||||||||||||||||||||||||||
13CPTAC_LUAD_Proteome_BI_20180629 | 13CPTAC_LUAD_W_BI_20180629_KR_f22.raw | CPTAC_Proteome | 20180524 | 20221101 | 29655624 | C3L-00001 | C3L.00001 | LUAD | 129C | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 4 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIA | United States | Not identified | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | No | EP400 | NP_056224.3(pre=K,post=N) | E1A-binding protein p400 GN=EP400 | PLLGMNPFQK | 801.9763 | 2 | 37312 | 37314 | 54.0 | 17982000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29656624 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | MIF | NP_002406.1(pre=K,post=L) | macrophage migration inhibitory factor GN=MIF | LLCGLLAER | 637.379 | 2 | 34632 | 34634 | 44.0 | 61965200.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29656635 | C3L-00604 | C3L.00604.N | LUAD | 127N | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | TUBA4A | NP_005991.1(pre=K,post=H) | tubulin alpha-4A chain isoform 1 GN=TUBA4A | TIGGGDDSFTTFFCETGAGK | 842.7481 | 3 | 34632 | 34637 | 110.0 | 6637510000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29656712 | C3N-00579 | C3N.00579 | LUAD | 128C | Tumor_and_Normal | 67 | Male | Other | 4 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Right | Stage IB | Vietnam | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | DNAJA2 | NP_005871.1(pre=K,post=R) | dnaJ homolog subfamily A member 2 GN=DNAJA2 | EISFAYEVLSNPEK | 521.7895 | 4 | 34664 | 34667 | 71.0 | 47079000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29657757 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | FASN | NP_004095.4(pre=R,post=L) | fatty acid synthase GN=FASN | LQLNGNLQLELAQVLAQERPK | 709.1709 | 4 | 43475 | 43482 | 144.0 | 829831000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29658331 | C3N-01024 | C3N.01024 | LUAD | 129C | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | NQO1 | NP_000894.1(pre=K,post=A) | NAD(P)H dehydrogenase [quinone] 1 isoform a GN=NQO1 | RLENIWDETPLYF | 963.0028 | 2 | 43741 | 43746 | 52.0 | 228093000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29658439 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | STX5 | NP_003155.2(pre=K,post=Q) | syntaxin-5 isoform 1 GN=STX5 | AVEIEELTYIIK | 627.0478 | 3 | 43804 | 43809 | 125.0 | 1825390000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29658980 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | STARD10 | NP_006636.2(pre=R,post=H) | START domain-containing protein 10 GN=STARD10 | SWLPMGADYIIMNYSVK | 821.4373 | 3 | 44044 | 44056 | 119.0 | 48106600.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29659312 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | CMPK1 | NP_057392.1(pre=K,post=G) | UMP-CMP kinase isoform a GN=CMPK1 | PLVVFVLGGPGAGK | 885.0631 | 2 | 44191 | 44192 | 147.0 | 1581340000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29659313 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | CMPK1 | NP_057392.1(pre=K,post=G) | UMP-CMP kinase isoform a GN=CMPK1 | PLVVFVLGGPGAGK | 885.0631 | 2 | 44191 | 44192 | 147.0 | 1581340000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29659554 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | PLD3 | NP_001026866.1(pre=R,post=D) | phospholipase D3 GN=PLD3 | AFLLSLAALR | 435.2805 | 3 | 44254 | 44260 | 114.0 | 107544000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29659688 | C3N-01024 | C3N.01024.N | LUAD | 130N | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | BAG2 | NP_004273.1(pre=K,post=Q) | BAG family molecular chaperone regulator 2 GN=BAG2 | EILLEMIHSIQNSQDMR | 762.7295 | 3 | 44317 | 44320 | 208.0 | 568809000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29660079 | C3L-00080 | C3L.00080 | LUAD | 126 | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | HSPG2 | NP_001278789.1(pre=K,post=A) | basement membrane-specific heparan sulfate proteoglycan core protein isoform a precursor GN=HSPG2 | FQGLDLNEELYLGGYPDYGAIPK | 758.4034 | 4 | 44731 | 44734 | 98.0 | 2391870000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29661206 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | UGDH | NP_003350.1(pre=K,post=K) | UDP-glucose 6-dehydrogenase isoform 1 GN=UGDH | IAILGFAFK | 479.9802 | 3 | 45842 | 45854 | 120.0 | 512024000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29661293 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | EEF1G | NP_001395.1(pre=P,post=L) | elongation factor 1-gamma GN=EEF1G | EELTQTFMSCNLITGMFQR | 851.0906 | 3 | 45939 | 45948 | 90.0 | 215604000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29661456 | C3N-01024 | C3N.01024.N | LUAD | 130N | Tumor_and_Normal | 66 | Female | Other | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | Vietnam | Present | Seventh Edition (2010) | pT3 | pN0 | No pathologic evidence of distant metastasis | cM0 | No | EPPK1 | NP_112598.3(pre=R,post=R) | epiplakin GN=EPPK1 | EELLAEFGSGTLDLPALTR | 754.4124 | 3 | 46127 | 46131 | 108.0 | 9266880000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29661604 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | CST3 | NP_000090.1(pre=K,post=S) | cystatin-C precursor GN=CST3 | AFCSFQIYAVPWQGTMTLSK | 931.8258 | 3 | 46227 | 46238 | 135.0 | 16062900.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29661718 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | KMT2B | NP_055542.1(pre=R,post=N) | histone-lysine N-methyltransferase 2B GN=KMT2B | ARPPEDLPSEIVDFVLK | 795.1297 | 3 | 46291 | 46295 | 109.0 | 6913720000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29662284 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | HBB | NP_000509.1(pre=R,post=V) | hemoglobin subunit beta GN=HBB | LLGNVLVCVLAHHFGKEFTPPVQAAYQK | 956.7976 | 4 | 46522 | 46533 | 234.0 | 42254900.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29662853 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | HPX | NP_000604.1(pre=K,post=G) | hemopexin precursor GN=HPX | LYLVQGTQVYVFLTK | 1115.669 | 2 | 46732 | 46740 | 280.0 | 122229000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29663277 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | HBB | NP_000509.1(pre=R,post=H) | hemoglobin subunit beta GN=HBB | LLGNVLVCVLAH | 512.9751 | 3 | 46858 | 46867 | 74.0 | 44032200.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29663740 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | PACS1 | NP_060496.2(pre=K,post=I) | phosphofurin acidic cluster sorting protein 1 GN=PACS1 | VVYDQLNQILVSDAALPENV | 810.4441 | 3 | 47005 | 47013 | 93.0 | 366502000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29663797 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | GALK1 | NP_000145.1(pre=R,post=M) | galactokinase GN=GALK1 | SLRDDYEVSCPELDQLVEAALAVPGVYGSR | 885.1976 | 4 | 47026 | 47029 | 241.0 | 244079000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29664013 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | NP_001265476.1(pre=K,post=S) | NIIGLLNVFTPQK | 639.0668 | 3 | 47068 | 47082 | 119.0 | 166399000.0 | ||||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29664406 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | PLS1 | NP_001138791.1(pre=K,post=P) | plastin-1 GN=PLS1 | LNLAFVANLFNTYPCLHK | 649.1166 | 4 | 47173 | 47188 | 95.0 | 109299000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29664742 | C3N-00547 | C3N.00547.N | LUAD | 128N | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | KTN1 | NP_001072989.1(pre=K,post=E) | kinectin isoform a GN=KTN1 | TMMFSEDEALCVVDLLK | 1230.138 | 2 | 47278 | 47294 | 254.0 | 15275400.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29664879 | C3N-00547 | C3N.00547 | LUAD | 127C | Tumor_and_Normal | 60 | Male | Other | 5 | Acinar adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IIA | Vietnam | Not identified | Seventh Edition (2010) | pT2b | pN0 | Staging Incomplete | cM0 | No | PPP1R10 | NP_002705.2(pre=K,post=G) | serine/threonine-protein phosphatase 1 regulatory subunit 10 GN=PPP1R10 | LPPVLANLMGSMGAGK | 672.0571 | 3 | 47320 | 47335 | 136.0 | 97302500.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29665301 | C3N-01023 | C3N.01023 | LUAD | 128C | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | ARFGEF1 | NP_006412.2(pre=K,post=M) | brefeldin A-inhibited guanine nucleotide-exchange protein 1 GN=ARFGEF1 | ATLTQMLNVIFAR | 853.9971 | 2 | 47467 | 47476 | 153.0 | 154535000.0 | ||||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29665424 | C3L-00080 | C3L.00080.N | LUAD | 127N | Tumor_and_Normal | 58 | Male | White | Not-Hispanic or Latino | Lower Lobe | 4 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IB | Other: Unknown | Not identified | Seventh Edition (2010) | pT2a | pN0 | Staging Incomplete | cM0 | No | GNPNAT1 | NP_932332.1(pre=K,post=K) | glucosamine 6-phosphate N-acetyltransferase GN=GNPNAT1 | LLLSTLTLLSK | 554.0413 | 3 | 47488 | 47507 | 121.0 | 164718000.0 | ||||||||||||||||||||||||||||
21CPTAC_LUAD_Proteome_BI_20180817 | 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw | CPTAC_Proteome | 20180524 | 20221101 | 29665468 | C3N-01023 | C3N.01023.N | LUAD | 129N | Tumor_and_Normal | 58 | Male | Other | 6 | Solid adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIIA | Vietnam | Present | Seventh Edition (2010) | pT2a | pN2 | Staging Incomplete | cM0 | No | LCP1 | NP_002289.2(pre=K,post=Y) | plastin-2 GN=LCP1 | LNLAFIANLFNR | 817.9856 | 2 | 47509 | 47516 | 188.0 | 7059290000.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29665836 | C3N-00199 | C3N.00199 | LUAD | 127C | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | HPS6 | NP_079023.2(pre=K,post=E) | Hermansky-Pudlak syndrome 6 protein GN=HPS6 | AVLQAVGQLVQK | 856.5482 | 2 | 35179 | 35185 | 152.0 | 13933000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29666420 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | CALR | NP_004334.1(pre=K,post=I) | calreticulin precursor GN=CALR | DDEFTHLYTLIVRPDNTYEVK | 1009.5357 | 3 | 35447 | 35449 | 146.0 | 845596000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29666551 | C3N-02582 | C3N.02582.N | LUAD | 130N | Tumor_and_Normal | 77 | Male | Upper Lobe | 6 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Left | Stage IIA | China | Not identified | Seventh Edition (2010) | pT2b | pN1 | Staging Incomplete | cM0 | No | EFTUD2 | NP_001245282.1(pre=K,post=R) | 116 kDa U5 small nuclear ribonucleoprotein component isoform a GN=EFTUD2 | IYADTFGDINYQEFAK | 1177.1108 | 2 | 35480 | 35493 | 92.0 | 22512200.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29666690 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | DDB1 | NP_001914.3(pre=K,post=H) | DNA damage-binding protein 1 GN=DDB1 | FLYGCQAPTICFVYQDPQGR | 883.7655 | 3 | 35520 | 35528 | 109.0 | 2113700000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29666783 | C3L-00604 | C3L.00604 | LUAD | 126 | Tumor_and_Normal | 61 | Female | White | Not-Hispanic or Latino | Upper Lobe | 3 | Acinar adenocarcinoma | G2 Moderately differentiated | Multifocal | Right | Stage IIIA | United States | Not identified | Seventh Edition (2010) | pT3 | pN2 | No pathologic evidence of distant metastasis | cM0 | No | C1QBP | NP_001203.1(pre=K,post=V) | complement component 1 Q subcomponent-binding protein, mitochondrial precursor GN=C1QBP | ITVTFNINNSIPPTFDGEEEPSQGQK | 1107.5748 | 3 | 35580 | 35587 | 133.0 | 380693000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29666802 | C3N-02379 | C3N.02379.1 | LUAD | 130C | Tumor_and_Normal | 57 | Female | Upper Lobe | 4 | Adenocarcinoma | G3 Poorly differentiated | Unifocal | Right | Stage IIB | China | Not identified | Seventh Edition (2010) | pT2a | pN1 | Staging Incomplete | cM0 | No | UHRF1 | NP_037414.3(pre=K,post=E) | E3 ubiquitin-protein ligase UHRF1 isoform 2 GN=UHRF1 | KLGLTMQYPEGYLEALANR | 875.8185 | 3 | 35589 | 35600 | 44.0 | 38293400.0 | ||||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29667041 | C3N-00199 | C3N.00199.N | LUAD | 128N | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | AGRN | NP_001292204.1(pre=R,post=S) | agrin isoform 1 precursor GN=AGRN | AAAVSSGFDGAIQLV | 817.9539 | 2 | 35713 | 35716 | 134.0 | 164576000.0 | ||||||||||||||||||||||||||||
23CPTAC_LUAD_Proteome_BI_20180822 | 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw | CPTAC_Proteome | 20180524 | 20221101 | 29667446 | C3N-00199 | C3N.00199 | LUAD | 127C | Tumor_and_Normal | 65 | Male | White | Not-Hispanic or Latino | Upper Lobe | 3 | Adenocarcinoma | G2 Moderately differentiated | Unifocal | Left | Stage IA | United States | Not identified | Seventh Edition (2010) | pT1b | pN0 | Staging Incomplete | Staging Incomplete | No | ELANE | NP_001963.1(pre=F,post=S) | neutrophil elastase preproprotein GN=ELANE | VNWIDSIIQR | 736.9259 | 2 | 35919 | 35923 | 113.0 | 127802000.0 |
판매제공처 홈페이지 | 판매담당자 | 연락처 | 이메일 |
---|---|---|---|
www.cellkey.co.kr | 셀키 | 0507-1387-0260 | sylee@cellkey.co.kr |
제약 및 취소/환불 규정 안내 |
---|
데이터 상품은 디지털화된 상품의 특성상 반품, 취소, 환불 되지 않으나 데이터의 심각한 오류, 상이한 데이터에 한하여 구매자가 요구하는 경우 환불을 진행할 수 있습니다. |